Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4KXG8

Protein Details
Accession A0A3N4KXG8    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
53-79RNLYIQPSKGKRSRKRKREFLSNPLAAHydrophilic
NLS Segment(s)
PositionSequence
61-70KGKRSRKRKR
Subcellular Location(s) nucl 14, cyto_nucl 10.833, mito_nucl 10.833, mito 6.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013241  RNase_P_Pop3  
Gene Ontology GO:0006364  P:rRNA processing  
GO:0008033  P:tRNA processing  
Pfam View protein in Pfam  
PF08228  RNase_P_pop3  
Amino Acid Sequences MAQFIKGQDPKKKITFSLDSPNTTVGWPEVSSANQDTILDLLCSLLEPIGQHRNLYIQPSKGKRSRKRKREFLSNPLAASVLPIPPPSPPELNSFITIGLNSTTRHLESLAKALPTETTTPRPRLAVFVCRSDSQPSQLHSHLPLLCGIVSKASPGLPIRLVQLPKGAQARLETSLAIPQAGFLGLMEGAPGSTVLLQFLDGNVPAIKIPWLEGFPGYQTTMIKAMTTTAPQLKKAQKEYAVKKVVRVDRSGKPGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.56
3 0.53
4 0.59
5 0.57
6 0.53
7 0.5
8 0.49
9 0.41
10 0.34
11 0.3
12 0.19
13 0.16
14 0.13
15 0.13
16 0.13
17 0.13
18 0.17
19 0.17
20 0.17
21 0.16
22 0.15
23 0.14
24 0.13
25 0.13
26 0.09
27 0.08
28 0.07
29 0.06
30 0.06
31 0.06
32 0.05
33 0.05
34 0.05
35 0.1
36 0.17
37 0.18
38 0.18
39 0.18
40 0.22
41 0.23
42 0.29
43 0.28
44 0.26
45 0.34
46 0.4
47 0.48
48 0.51
49 0.6
50 0.64
51 0.72
52 0.77
53 0.8
54 0.85
55 0.87
56 0.89
57 0.9
58 0.87
59 0.85
60 0.84
61 0.75
62 0.65
63 0.55
64 0.46
65 0.34
66 0.28
67 0.2
68 0.11
69 0.09
70 0.09
71 0.09
72 0.09
73 0.12
74 0.13
75 0.14
76 0.14
77 0.19
78 0.23
79 0.25
80 0.25
81 0.24
82 0.21
83 0.19
84 0.17
85 0.13
86 0.09
87 0.08
88 0.08
89 0.09
90 0.09
91 0.09
92 0.1
93 0.11
94 0.12
95 0.12
96 0.15
97 0.16
98 0.14
99 0.14
100 0.14
101 0.13
102 0.13
103 0.15
104 0.13
105 0.18
106 0.21
107 0.24
108 0.25
109 0.25
110 0.24
111 0.25
112 0.25
113 0.26
114 0.25
115 0.26
116 0.27
117 0.27
118 0.28
119 0.28
120 0.26
121 0.22
122 0.23
123 0.22
124 0.24
125 0.24
126 0.24
127 0.21
128 0.25
129 0.21
130 0.18
131 0.17
132 0.14
133 0.13
134 0.12
135 0.11
136 0.07
137 0.07
138 0.06
139 0.06
140 0.06
141 0.08
142 0.08
143 0.1
144 0.1
145 0.11
146 0.13
147 0.17
148 0.17
149 0.16
150 0.2
151 0.18
152 0.22
153 0.23
154 0.21
155 0.18
156 0.19
157 0.21
158 0.19
159 0.19
160 0.15
161 0.13
162 0.15
163 0.14
164 0.12
165 0.1
166 0.07
167 0.07
168 0.07
169 0.06
170 0.04
171 0.04
172 0.04
173 0.04
174 0.04
175 0.03
176 0.03
177 0.03
178 0.04
179 0.03
180 0.04
181 0.04
182 0.04
183 0.05
184 0.05
185 0.05
186 0.06
187 0.07
188 0.06
189 0.08
190 0.08
191 0.08
192 0.07
193 0.08
194 0.09
195 0.08
196 0.09
197 0.1
198 0.11
199 0.12
200 0.13
201 0.13
202 0.14
203 0.16
204 0.15
205 0.14
206 0.14
207 0.14
208 0.16
209 0.15
210 0.14
211 0.12
212 0.14
213 0.14
214 0.15
215 0.18
216 0.24
217 0.26
218 0.29
219 0.37
220 0.42
221 0.48
222 0.53
223 0.56
224 0.57
225 0.65
226 0.69
227 0.71
228 0.73
229 0.66
230 0.65
231 0.67
232 0.66
233 0.61
234 0.59
235 0.56
236 0.54