Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4KU97

Protein Details
Accession A0A3N4KU97    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
84-103YIRIRSRRGKHGQDRGWREGBasic
NLS Segment(s)
Subcellular Location(s) mito 10, plas 9, golg 3, vacu 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MRRLYFGAGRGLRLCFFVSFIFSSEVLLVVAPPIAKEGKKDTSRRWTARHEATRKKSFTFFKTSIYTLNTFGRVVWYPTIIYYYIRIRSRRGKHGQDRGWREGFWVSWVIMDLAYCLSIKRQRRDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.17
3 0.17
4 0.15
5 0.16
6 0.14
7 0.16
8 0.17
9 0.15
10 0.15
11 0.14
12 0.13
13 0.1
14 0.09
15 0.07
16 0.05
17 0.06
18 0.05
19 0.05
20 0.06
21 0.08
22 0.09
23 0.11
24 0.17
25 0.24
26 0.32
27 0.36
28 0.42
29 0.5
30 0.59
31 0.62
32 0.62
33 0.6
34 0.61
35 0.66
36 0.68
37 0.66
38 0.67
39 0.71
40 0.74
41 0.68
42 0.63
43 0.59
44 0.54
45 0.5
46 0.48
47 0.41
48 0.36
49 0.37
50 0.35
51 0.31
52 0.29
53 0.26
54 0.2
55 0.21
56 0.18
57 0.15
58 0.14
59 0.15
60 0.13
61 0.13
62 0.11
63 0.11
64 0.1
65 0.1
66 0.12
67 0.1
68 0.1
69 0.11
70 0.14
71 0.2
72 0.25
73 0.26
74 0.31
75 0.4
76 0.46
77 0.54
78 0.59
79 0.63
80 0.68
81 0.77
82 0.8
83 0.8
84 0.81
85 0.77
86 0.71
87 0.6
88 0.52
89 0.44
90 0.36
91 0.29
92 0.23
93 0.16
94 0.14
95 0.15
96 0.13
97 0.11
98 0.1
99 0.08
100 0.07
101 0.08
102 0.07
103 0.07
104 0.13
105 0.21
106 0.29