Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4KBZ7

Protein Details
Accession A0A3N4KBZ7    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
6-33SDECFLYRLRMKKRWRRRGATNRDVRTGHydrophilic
NLS Segment(s)
PositionSequence
15-24RMKKRWRRRG
Subcellular Location(s) mito 19, nucl 5, cyto 2
Family & Domain DBs
Amino Acid Sequences MWMKGSDECFLYRLRMKKRWRRRGATNRDVRTGREEQAPGCELTVVAPLEVWSGKIALSFLEHRCAQGVFNKYPLIKGSPALSSCFSGETSGVPVIERI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.45
3 0.55
4 0.65
5 0.75
6 0.81
7 0.85
8 0.85
9 0.88
10 0.9
11 0.9
12 0.9
13 0.89
14 0.81
15 0.78
16 0.71
17 0.61
18 0.57
19 0.5
20 0.41
21 0.36
22 0.33
23 0.27
24 0.29
25 0.29
26 0.22
27 0.18
28 0.16
29 0.1
30 0.1
31 0.12
32 0.08
33 0.06
34 0.06
35 0.06
36 0.07
37 0.07
38 0.07
39 0.04
40 0.04
41 0.04
42 0.04
43 0.05
44 0.04
45 0.06
46 0.09
47 0.1
48 0.14
49 0.15
50 0.15
51 0.16
52 0.16
53 0.15
54 0.18
55 0.23
56 0.2
57 0.22
58 0.25
59 0.24
60 0.25
61 0.26
62 0.24
63 0.19
64 0.19
65 0.19
66 0.21
67 0.22
68 0.23
69 0.23
70 0.21
71 0.21
72 0.2
73 0.18
74 0.15
75 0.14
76 0.13
77 0.14
78 0.14
79 0.13