FuNGI

K1VVG3

Protein Details

Accession

K1VVG3

Localization Confidence

Medium

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
13-34	PAEGVEKPKPRRRFVGKTPGSA	Hydrophilic
490-519	DGSLGPWTPRHRPPRPPREPRPPRMTKVAT	Hydrophilic

NLS Segment(s)

Position	Sequence
19-32	KPKPRRRFVGKTPG
499-513	RHRPPRPPREPRPPR

Subcellular Location(s)

cyto 15.5, cyto_nucl 9, mito 6, cysk 3

Family & Domain DBs

InterPro	View protein in InterPro IPR016435 DPH1/DPH2 IPR042263 DPH1/DPH2_1 IPR042264 DPH1/DPH2_2 IPR042265 DPH1/DPH2_3 IPR035435 DPH1/DPH2_euk_archaea
Gene Ontology	GO:0090560 F:2-(3-amino-3-carboxypropyl)histidine synthase activity GO:0051539 F:4 iron, 4 sulfur cluster binding GO:0046872 F:metal ion binding GO:0017183 P:peptidyl-diphthamide biosynthetic process from peptidyl-histidine
Pfam	View protein in Pfam PF01866 Diphthamide_syn

Amino Acid Sequences

MSTVPEQAPAAAPAEGVEKPKPRRRFVGKTPGSAARTAPRRVANQVPDEILNDPALKEAMAALPGNYNFEIPKTIHHVRREGVKTVALQMPEGLMMYGCAIADIVERFTGAQPLLLADVTYGACCIDDFTAREMGAEMIVHYGHSCLIPVNQTSIKTLYIFVEIAIDSPHLALSVRRNFPSDREAFRRSVLGAGPAEPGAKVDIALEADEEKKLSEGAAAEGETPTRLALVGTIQFVAAVQALRDDLEQAMPPLEEQADGEGADDALAKVRKGEIGVWRGKYDVTIPQVRPLSPGEILGCTAPRLPADVDALIYVGDGRFHLESIMIANPSVPAFRFDPYSKKFTREVYEHKEMRAIRGDAVRNARRNLVERGADSWAILLGTLGRQGSLSVLKTVQGSLPPGTDALPPLLILLSELSPAKLALFSKDEISTFVQTSCPRLSIDWGYAFSRPLLSSYEASVAAGRIQGWEGTEVDGKKGAGDYPMDFYADGSLGPWTPRHRPPRPPREPRPPRMTKVAT

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.14
2	0.15
3	0.17
4	0.22
5	0.29
6	0.38
7	0.48
8	0.56
9	0.6
10	0.68
11	0.75
12	0.79
13	0.81
14	0.83
15	0.8
16	0.78
17	0.77
18	0.75
19	0.67
20	0.58
21	0.51
22	0.48
23	0.49
24	0.45
25	0.46
26	0.44
27	0.46
28	0.5
29	0.56
30	0.54
31	0.52
32	0.52
33	0.48
34	0.43
35	0.41
36	0.36
37	0.29
38	0.23
39	0.18
40	0.15
41	0.13
42	0.13
43	0.11
44	0.09
45	0.09
46	0.09
47	0.1
48	0.1
49	0.09
50	0.13
51	0.14
52	0.17
53	0.16
54	0.16
55	0.14
56	0.15
57	0.18
58	0.14
59	0.18
60	0.23
61	0.31
62	0.37
63	0.42
64	0.45
65	0.45
66	0.55
67	0.55
68	0.5
69	0.45
70	0.41
71	0.37
72	0.38
73	0.38
74	0.29
75	0.24
76	0.21
77	0.19
78	0.16
79	0.14
80	0.09
81	0.05
82	0.05
83	0.05
84	0.05
85	0.05
86	0.04
87	0.04
88	0.04
89	0.06
90	0.07
91	0.07
92	0.07
93	0.07
94	0.08
95	0.09
96	0.11
97	0.09
98	0.09
99	0.08
100	0.09
101	0.1
102	0.09
103	0.08
104	0.06
105	0.07
106	0.07
107	0.07
108	0.06
109	0.05
110	0.05
111	0.05
112	0.07
113	0.06
114	0.08
115	0.1
116	0.12
117	0.15
118	0.14
119	0.15
120	0.14
121	0.13
122	0.11
123	0.1
124	0.08
125	0.06
126	0.06
127	0.06
128	0.06
129	0.06
130	0.06
131	0.06
132	0.06
133	0.06
134	0.07
135	0.1
136	0.1
137	0.14
138	0.16
139	0.16
140	0.18
141	0.19
142	0.18
143	0.17
144	0.17
145	0.14
146	0.14
147	0.13
148	0.11
149	0.11
150	0.1
151	0.09
152	0.09
153	0.08
154	0.06
155	0.06
156	0.06
157	0.05
158	0.05
159	0.07
160	0.14
161	0.22
162	0.25
163	0.26
164	0.29
165	0.3
166	0.32
167	0.38
168	0.35
169	0.33
170	0.37
171	0.4
172	0.39
173	0.39
174	0.37
175	0.3
176	0.27
177	0.21
178	0.18
179	0.15
180	0.14
181	0.14
182	0.13
183	0.13
184	0.1
185	0.1
186	0.07
187	0.07
188	0.06
189	0.05
190	0.06
191	0.06
192	0.06
193	0.06
194	0.06
195	0.07
196	0.07
197	0.07
198	0.06
199	0.06
200	0.06
201	0.05
202	0.06
203	0.05
204	0.06
205	0.07
206	0.07
207	0.07
208	0.07
209	0.07
210	0.06
211	0.06
212	0.05
213	0.04
214	0.04
215	0.03
216	0.04
217	0.05
218	0.06
219	0.06
220	0.07
221	0.06
222	0.06
223	0.06
224	0.06
225	0.05
226	0.04
227	0.03
228	0.04
229	0.04
230	0.04
231	0.04
232	0.05
233	0.04
234	0.05
235	0.05
236	0.05
237	0.06
238	0.05
239	0.05
240	0.05
241	0.05
242	0.05
243	0.04
244	0.05
245	0.05
246	0.05
247	0.05
248	0.04
249	0.04
250	0.04
251	0.04
252	0.03
253	0.06
254	0.06
255	0.06
256	0.06
257	0.07
258	0.07
259	0.08
260	0.11
261	0.14
262	0.2
263	0.25
264	0.26
265	0.26
266	0.26
267	0.25
268	0.22
269	0.18
270	0.16
271	0.16
272	0.22
273	0.22
274	0.26
275	0.28
276	0.28
277	0.28
278	0.25
279	0.22
280	0.17
281	0.17
282	0.13
283	0.12
284	0.12
285	0.1
286	0.09
287	0.07
288	0.08
289	0.07
290	0.06
291	0.08
292	0.08
293	0.09
294	0.1
295	0.1
296	0.09
297	0.09
298	0.09
299	0.07
300	0.06
301	0.05
302	0.04
303	0.04
304	0.03
305	0.05
306	0.05
307	0.05
308	0.06
309	0.05
310	0.06
311	0.07
312	0.09
313	0.07
314	0.07
315	0.07
316	0.07
317	0.08
318	0.08
319	0.07
320	0.08
321	0.09
322	0.1
323	0.14
324	0.15
325	0.24
326	0.27
327	0.34
328	0.33
329	0.36
330	0.39
331	0.39
332	0.43
333	0.42
334	0.46
335	0.48
336	0.56
337	0.53
338	0.5
339	0.51
340	0.45
341	0.42
342	0.4
343	0.32
344	0.26
345	0.3
346	0.32
347	0.32
348	0.4
349	0.43
350	0.41
351	0.41
352	0.42
353	0.39
354	0.41
355	0.41
356	0.38
357	0.34
358	0.3
359	0.32
360	0.3
361	0.28
362	0.23
363	0.19
364	0.13
365	0.1
366	0.09
367	0.06
368	0.04
369	0.05
370	0.06
371	0.06
372	0.06
373	0.06
374	0.06
375	0.08
376	0.11
377	0.11
378	0.11
379	0.12
380	0.13
381	0.14
382	0.14
383	0.14
384	0.13
385	0.14
386	0.14
387	0.14
388	0.13
389	0.13
390	0.14
391	0.13
392	0.13
393	0.11
394	0.1
395	0.1
396	0.09
397	0.09
398	0.07
399	0.07
400	0.07
401	0.06
402	0.08
403	0.08
404	0.08
405	0.08
406	0.08
407	0.08
408	0.09
409	0.1
410	0.12
411	0.15
412	0.15
413	0.18
414	0.19
415	0.19
416	0.19
417	0.22
418	0.21
419	0.19
420	0.19
421	0.21
422	0.21
423	0.25
424	0.24
425	0.22
426	0.2
427	0.2
428	0.25
429	0.24
430	0.27
431	0.26
432	0.27
433	0.27
434	0.27
435	0.27
436	0.23
437	0.21
438	0.17
439	0.16
440	0.17
441	0.18
442	0.18
443	0.19
444	0.21
445	0.19
446	0.19
447	0.18
448	0.15
449	0.13
450	0.13
451	0.11
452	0.09
453	0.1
454	0.1
455	0.1
456	0.12
457	0.12
458	0.13
459	0.18
460	0.18
461	0.18
462	0.2
463	0.19
464	0.18
465	0.18
466	0.17
467	0.15
468	0.17
469	0.17
470	0.19
471	0.2
472	0.2
473	0.19
474	0.18
475	0.17
476	0.15
477	0.13
478	0.09
479	0.1
480	0.1
481	0.11
482	0.15
483	0.19
484	0.26
485	0.36
486	0.46
487	0.53
488	0.63
489	0.73
490	0.81
491	0.87
492	0.9
493	0.91
494	0.92
495	0.95
496	0.94
497	0.93
498	0.91
499	0.86

K1VVG3

3D AlphaFold-predicted Structure Viewer