Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4KPM3

Protein Details
Accession A0A3N4KPM3   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
129-152NASPPRRRTTTPPRKARNRRAAFAHydrophilic
271-292DLPTRRTTYRRTKRQALREMAPHydrophilic
NLS Segment(s)
PositionSequence
133-148PRRRTTTPPRKARNRR
Subcellular Location(s) nucl 14.5, mito_nucl 14, mito 12.5
Family & Domain DBs
Amino Acid Sequences MAPSPILISTAPRAFGMKSTTFGNKMPTTFNTNRRSSPTKRPLAIFSDENVDPTHPKRVKSTLTSCEDKENILFDKKSPSVKNAKPSRFVLTDRTPQLPQQKVRTSTVTSRVEKSKPRVGSSLKNVILNASPPRRRTTTPPRKARNRRAAFAVRVDPPVLDKESAPNTSIDSVISSGSEIDSLSLPNNAIIPRDAIPDSWQFTIYEDSAEETLQNLMEHSATTLDLSDDETSRTELTDIGKENIPPTDEEERRYEENRHEETPTISPMSIDLPTRRTTYRRTKRQALREMAPAELVDEESEKPGKVPNLEKEGSVSVVTPEKPVLAPKLKGASKFAVWKDPSLTSVSNAALKASSRMKPRIDAGKKRGLSEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.24
3 0.27
4 0.23
5 0.23
6 0.26
7 0.3
8 0.31
9 0.32
10 0.36
11 0.33
12 0.33
13 0.36
14 0.35
15 0.4
16 0.45
17 0.52
18 0.53
19 0.55
20 0.57
21 0.6
22 0.64
23 0.62
24 0.65
25 0.66
26 0.67
27 0.67
28 0.67
29 0.64
30 0.62
31 0.61
32 0.51
33 0.42
34 0.39
35 0.34
36 0.32
37 0.27
38 0.23
39 0.21
40 0.22
41 0.31
42 0.28
43 0.3
44 0.35
45 0.41
46 0.46
47 0.51
48 0.57
49 0.56
50 0.59
51 0.62
52 0.57
53 0.56
54 0.5
55 0.43
56 0.36
57 0.3
58 0.27
59 0.28
60 0.28
61 0.23
62 0.29
63 0.32
64 0.38
65 0.36
66 0.4
67 0.44
68 0.49
69 0.58
70 0.6
71 0.63
72 0.61
73 0.62
74 0.61
75 0.55
76 0.52
77 0.5
78 0.47
79 0.49
80 0.47
81 0.47
82 0.42
83 0.43
84 0.49
85 0.49
86 0.47
87 0.48
88 0.53
89 0.53
90 0.56
91 0.55
92 0.5
93 0.48
94 0.52
95 0.51
96 0.46
97 0.46
98 0.49
99 0.5
100 0.53
101 0.53
102 0.52
103 0.48
104 0.48
105 0.5
106 0.49
107 0.52
108 0.52
109 0.55
110 0.49
111 0.46
112 0.43
113 0.38
114 0.33
115 0.28
116 0.28
117 0.27
118 0.29
119 0.3
120 0.35
121 0.37
122 0.39
123 0.45
124 0.5
125 0.53
126 0.6
127 0.68
128 0.73
129 0.81
130 0.89
131 0.91
132 0.9
133 0.84
134 0.77
135 0.74
136 0.71
137 0.63
138 0.56
139 0.5
140 0.4
141 0.36
142 0.33
143 0.25
144 0.2
145 0.2
146 0.16
147 0.13
148 0.11
149 0.14
150 0.16
151 0.17
152 0.17
153 0.15
154 0.14
155 0.14
156 0.14
157 0.11
158 0.08
159 0.07
160 0.07
161 0.06
162 0.05
163 0.05
164 0.04
165 0.05
166 0.04
167 0.04
168 0.04
169 0.05
170 0.05
171 0.05
172 0.05
173 0.05
174 0.07
175 0.06
176 0.07
177 0.07
178 0.08
179 0.08
180 0.1
181 0.1
182 0.09
183 0.12
184 0.14
185 0.15
186 0.14
187 0.14
188 0.12
189 0.13
190 0.15
191 0.12
192 0.1
193 0.08
194 0.09
195 0.09
196 0.08
197 0.07
198 0.06
199 0.06
200 0.06
201 0.06
202 0.05
203 0.05
204 0.05
205 0.05
206 0.05
207 0.05
208 0.05
209 0.05
210 0.05
211 0.05
212 0.05
213 0.06
214 0.07
215 0.07
216 0.08
217 0.08
218 0.09
219 0.09
220 0.09
221 0.08
222 0.08
223 0.1
224 0.13
225 0.14
226 0.16
227 0.17
228 0.17
229 0.18
230 0.18
231 0.17
232 0.13
233 0.17
234 0.24
235 0.24
236 0.26
237 0.28
238 0.31
239 0.34
240 0.36
241 0.34
242 0.32
243 0.39
244 0.41
245 0.4
246 0.37
247 0.35
248 0.35
249 0.34
250 0.3
251 0.23
252 0.18
253 0.16
254 0.15
255 0.16
256 0.15
257 0.15
258 0.15
259 0.16
260 0.19
261 0.22
262 0.24
263 0.25
264 0.33
265 0.42
266 0.51
267 0.58
268 0.64
269 0.72
270 0.79
271 0.86
272 0.87
273 0.82
274 0.76
275 0.73
276 0.66
277 0.55
278 0.47
279 0.36
280 0.27
281 0.2
282 0.16
283 0.08
284 0.09
285 0.09
286 0.11
287 0.12
288 0.11
289 0.11
290 0.15
291 0.18
292 0.22
293 0.28
294 0.33
295 0.4
296 0.41
297 0.4
298 0.39
299 0.38
300 0.33
301 0.27
302 0.2
303 0.14
304 0.18
305 0.18
306 0.17
307 0.16
308 0.16
309 0.16
310 0.19
311 0.25
312 0.27
313 0.28
314 0.32
315 0.4
316 0.42
317 0.44
318 0.45
319 0.42
320 0.4
321 0.47
322 0.44
323 0.45
324 0.44
325 0.44
326 0.43
327 0.4
328 0.37
329 0.34
330 0.32
331 0.24
332 0.26
333 0.25
334 0.25
335 0.23
336 0.22
337 0.19
338 0.19
339 0.22
340 0.25
341 0.3
342 0.34
343 0.41
344 0.44
345 0.47
346 0.54
347 0.59
348 0.63
349 0.68
350 0.68
351 0.72
352 0.7