FuNGI

A0A3N4K9P6

Protein Details

Accession

A0A3N4K9P6

Localization Confidence

Medium

Confidence Score

13.2

NoLS Segment(s)

Position	Sequence	Protein Nature
81-108	PPVDSPEKGTSRRRKRRRSPNVTVTLNG	Hydrophilic

NLS Segment(s)

Position	Sequence
88-98	KGTSRRRKRRR

Subcellular Location(s)

nucl 21, cyto_nucl 14, cyto 5

Family & Domain DBs

InterPro	View protein in InterPro IPR007681 Mog1
CDD	cd18724 PIN_LabA-like

Amino Acid Sequences

MSSIGFDLSPVIDLLDTLSAGPKNPFELDPGAVASDASGDVRSLGDFSALWSFLNDCHNDSTPLPSLDSILTPPPSPPPPPPVDSPEKGTSRRRKRRRSPNVTVTLNGTSIAPEQSPATDSTENHTDTTEEIPRKPPRTRIRVTSTFANSANSAEKTSRSTPRIRLTPASILPRDDGLAPVVQSNSLQRPVIRTSGLPVSERKAQLIQMIIRLFPSDRVTLLTLDIPRPLAPQPTDIHVFIDNSNILISFYELIKQIRGQPKTARVRAPKFSFHNFSLILERGRPTVKKALVGSSPITPVMLEAEALGYENSILERVVKERTVKYSSSSGSDTNSPLKTRMAKVEQAVDEILHLKMMESIVDYEPSTLVLASGDAAAGEYSPGFFKVVERALTKGWNVELVAFKKSLGFSYKAAEFKTKWKGKFRYIQLDQFAEMLLDE

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.08
2	0.08
3	0.08
4	0.07
5	0.11
6	0.11
7	0.13
8	0.15
9	0.15
10	0.18
11	0.2
12	0.21
13	0.21
14	0.23
15	0.23
16	0.22
17	0.22
18	0.19
19	0.17
20	0.16
21	0.11
22	0.09
23	0.08
24	0.07
25	0.07
26	0.06
27	0.07
28	0.07
29	0.08
30	0.07
31	0.07
32	0.07
33	0.07
34	0.09
35	0.12
36	0.12
37	0.12
38	0.12
39	0.12
40	0.14
41	0.2
42	0.19
43	0.18
44	0.22
45	0.24
46	0.26
47	0.26
48	0.28
49	0.27
50	0.27
51	0.26
52	0.22
53	0.22
54	0.2
55	0.2
56	0.17
57	0.17
58	0.17
59	0.16
60	0.17
61	0.21
62	0.24
63	0.26
64	0.28
65	0.32
66	0.36
67	0.39
68	0.43
69	0.45
70	0.49
71	0.48
72	0.51
73	0.51
74	0.51
75	0.52
76	0.58
77	0.61
78	0.65
79	0.73
80	0.78
81	0.81
82	0.87
83	0.93
84	0.94
85	0.94
86	0.93
87	0.93
88	0.92
89	0.83
90	0.73
91	0.65
92	0.55
93	0.45
94	0.34
95	0.24
96	0.15
97	0.14
98	0.13
99	0.1
100	0.09
101	0.09
102	0.09
103	0.11
104	0.11
105	0.15
106	0.16
107	0.16
108	0.2
109	0.25
110	0.26
111	0.24
112	0.23
113	0.19
114	0.18
115	0.22
116	0.24
117	0.21
118	0.22
119	0.3
120	0.37
121	0.42
122	0.45
123	0.51
124	0.54
125	0.61
126	0.64
127	0.65
128	0.67
129	0.68
130	0.67
131	0.65
132	0.59
133	0.52
134	0.48
135	0.41
136	0.32
137	0.26
138	0.26
139	0.19
140	0.17
141	0.14
142	0.15
143	0.18
144	0.23
145	0.28
146	0.3
147	0.34
148	0.4
149	0.46
150	0.5
151	0.49
152	0.47
153	0.43
154	0.45
155	0.43
156	0.43
157	0.36
158	0.32
159	0.29
160	0.27
161	0.23
162	0.18
163	0.14
164	0.09
165	0.09
166	0.08
167	0.08
168	0.08
169	0.07
170	0.08
171	0.09
172	0.11
173	0.12
174	0.12
175	0.12
176	0.15
177	0.17
178	0.19
179	0.17
180	0.15
181	0.16
182	0.19
183	0.2
184	0.18
185	0.17
186	0.18
187	0.22
188	0.23
189	0.21
190	0.18
191	0.18
192	0.18
193	0.2
194	0.18
195	0.16
196	0.16
197	0.15
198	0.14
199	0.14
200	0.12
201	0.11
202	0.13
203	0.09
204	0.09
205	0.11
206	0.11
207	0.11
208	0.12
209	0.12
210	0.11
211	0.11
212	0.11
213	0.1
214	0.1
215	0.11
216	0.11
217	0.12
218	0.11
219	0.14
220	0.15
221	0.17
222	0.2
223	0.18
224	0.19
225	0.16
226	0.17
227	0.13
228	0.14
229	0.11
230	0.09
231	0.09
232	0.07
233	0.07
234	0.06
235	0.06
236	0.05
237	0.05
238	0.06
239	0.08
240	0.08
241	0.09
242	0.1
243	0.17
244	0.24
245	0.25
246	0.27
247	0.31
248	0.4
249	0.48
250	0.52
251	0.53
252	0.54
253	0.58
254	0.63
255	0.63
256	0.6
257	0.56
258	0.57
259	0.54
260	0.47
261	0.44
262	0.36
263	0.33
264	0.3
265	0.27
266	0.22
267	0.18
268	0.18
269	0.16
270	0.19
271	0.18
272	0.19
273	0.25
274	0.26
275	0.29
276	0.29
277	0.31
278	0.3
279	0.32
280	0.29
281	0.23
282	0.22
283	0.18
284	0.17
285	0.12
286	0.11
287	0.1
288	0.08
289	0.06
290	0.05
291	0.05
292	0.05
293	0.06
294	0.06
295	0.04
296	0.04
297	0.04
298	0.04
299	0.04
300	0.04
301	0.05
302	0.06
303	0.08
304	0.11
305	0.14
306	0.18
307	0.21
308	0.27
309	0.3
310	0.29
311	0.31
312	0.34
313	0.33
314	0.32
315	0.31
316	0.26
317	0.25
318	0.27
319	0.26
320	0.26
321	0.27
322	0.25
323	0.24
324	0.28
325	0.31
326	0.32
327	0.37
328	0.37
329	0.39
330	0.4
331	0.46
332	0.42
333	0.38
334	0.35
335	0.27
336	0.22
337	0.19
338	0.17
339	0.1
340	0.09
341	0.07
342	0.09
343	0.09
344	0.08
345	0.08
346	0.11
347	0.11
348	0.13
349	0.13
350	0.12
351	0.12
352	0.12
353	0.11
354	0.08
355	0.07
356	0.06
357	0.06
358	0.05
359	0.05
360	0.05
361	0.04
362	0.05
363	0.04
364	0.04
365	0.04
366	0.04
367	0.05
368	0.06
369	0.07
370	0.07
371	0.07
372	0.09
373	0.15
374	0.19
375	0.22
376	0.23
377	0.25
378	0.27
379	0.3
380	0.3
381	0.26
382	0.23
383	0.21
384	0.2
385	0.21
386	0.26
387	0.25
388	0.27
389	0.24
390	0.24
391	0.24
392	0.25
393	0.25
394	0.23
395	0.24
396	0.22
397	0.28
398	0.33
399	0.34
400	0.35
401	0.38
402	0.35
403	0.41
404	0.5
405	0.53
406	0.55
407	0.62
408	0.68
409	0.71
410	0.79
411	0.79
412	0.8
413	0.79
414	0.8
415	0.76
416	0.71
417	0.62
418	0.52
419	0.42

A0A3N4K9P6

3D AlphaFold-predicted Structure Viewer