Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4KWX1

Protein Details
Accession A0A3N4KWX1    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
24-50IPSREIKKIKIKIKNKKKQHRNHMYIIHydrophilic
NLS Segment(s)
PositionSequence
28-43EIKKIKIKIKNKKKQH
Subcellular Location(s) mito 15, nucl 8.5, cyto_nucl 6, cyto 2.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MRTHELGMFRLQCSRQHFWKPCGIPSREIKKIKIKIKNKKKQHRNHMYIIWLAIGCIPPVHVSTYVIVPHHHHVLHRHLITPFQKRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.43
3 0.51
4 0.56
5 0.55
6 0.62
7 0.59
8 0.58
9 0.61
10 0.56
11 0.51
12 0.54
13 0.58
14 0.58
15 0.59
16 0.57
17 0.57
18 0.63
19 0.66
20 0.66
21 0.69
22 0.71
23 0.79
24 0.84
25 0.85
26 0.87
27 0.89
28 0.89
29 0.9
30 0.9
31 0.85
32 0.8
33 0.72
34 0.64
35 0.54
36 0.44
37 0.33
38 0.22
39 0.16
40 0.11
41 0.09
42 0.06
43 0.05
44 0.06
45 0.06
46 0.07
47 0.09
48 0.08
49 0.09
50 0.1
51 0.13
52 0.14
53 0.14
54 0.15
55 0.16
56 0.19
57 0.22
58 0.22
59 0.22
60 0.26
61 0.32
62 0.4
63 0.38
64 0.39
65 0.36
66 0.43
67 0.48