Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4KST8

Protein Details
Accession A0A3N4KST8    Localization Confidence Low Confidence Score 6.3
NoLS Segment(s)
PositionSequenceProtein Nature
63-83AVVVRTKKKYRRPDGSYIRFDHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11.5, mito 11, cyto_nucl 8.5, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036853  Ribosomal_L14_sf  
IPR000218  Ribosomal_L14P  
IPR005745  Ribosomal_L14P_bac-type  
IPR019972  Ribosomal_L14P_CS  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00238  Ribosomal_L14  
PROSITE View protein in PROSITE  
PS00049  RIBOSOMAL_L14  
Amino Acid Sequences MLTCIDNSGAALVECAQVLKRKKPAGIGDKIVVVIQKQRSLGHDLSAAAQAAVKVRRGDVCHAVVVRTKKKYRRPDGSYIRFDDNACVLVNKSGDPLGTRLNSVVGEELRRKKWSKILSLAPMNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.09
4 0.15
5 0.2
6 0.27
7 0.34
8 0.38
9 0.4
10 0.46
11 0.54
12 0.56
13 0.58
14 0.55
15 0.48
16 0.45
17 0.43
18 0.36
19 0.27
20 0.19
21 0.18
22 0.17
23 0.18
24 0.19
25 0.19
26 0.21
27 0.27
28 0.26
29 0.22
30 0.21
31 0.19
32 0.19
33 0.18
34 0.16
35 0.1
36 0.09
37 0.08
38 0.09
39 0.1
40 0.11
41 0.1
42 0.11
43 0.14
44 0.15
45 0.18
46 0.19
47 0.19
48 0.19
49 0.19
50 0.18
51 0.2
52 0.23
53 0.26
54 0.29
55 0.34
56 0.4
57 0.49
58 0.59
59 0.65
60 0.7
61 0.72
62 0.75
63 0.8
64 0.81
65 0.77
66 0.7
67 0.63
68 0.54
69 0.47
70 0.38
71 0.28
72 0.21
73 0.16
74 0.13
75 0.1
76 0.11
77 0.11
78 0.1
79 0.1
80 0.09
81 0.1
82 0.1
83 0.12
84 0.15
85 0.15
86 0.16
87 0.15
88 0.16
89 0.16
90 0.15
91 0.16
92 0.13
93 0.17
94 0.24
95 0.3
96 0.34
97 0.4
98 0.42
99 0.44
100 0.51
101 0.55
102 0.56
103 0.58
104 0.62
105 0.65