Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4KQ84

Protein Details
Accession A0A3N4KQ84    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
84-106KNLELKLKPKKKPSWFRKKMGLTHydrophilic
NLS Segment(s)
PositionSequence
89-102KLKPKKKPSWFRKK
Subcellular Location(s) cysk 13, nucl 6, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR031348  Helo-like_N  
Pfam View protein in Pfam  
PF17111  Helo_like_N  
Amino Acid Sequences MEGLGIAASIIGVIQLTGKVSSLGYGYISKVGQAQQEIESFLKELASLEKFLELIDSYVKAGTATSDALQALDEPLRTCMRELKNLELKLKPKKKPSWFRKKMGLTSLMWPLKEKEVTEIIIRIERNKTSFLLALSLDNISQLRANLIAQGSSRQADDSARAGM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.04
3 0.05
4 0.06
5 0.06
6 0.07
7 0.07
8 0.08
9 0.08
10 0.08
11 0.09
12 0.1
13 0.1
14 0.12
15 0.12
16 0.12
17 0.13
18 0.15
19 0.16
20 0.16
21 0.17
22 0.16
23 0.17
24 0.19
25 0.17
26 0.16
27 0.14
28 0.12
29 0.1
30 0.08
31 0.08
32 0.1
33 0.1
34 0.11
35 0.1
36 0.11
37 0.11
38 0.1
39 0.11
40 0.07
41 0.07
42 0.07
43 0.07
44 0.07
45 0.07
46 0.07
47 0.06
48 0.06
49 0.06
50 0.06
51 0.06
52 0.06
53 0.07
54 0.07
55 0.07
56 0.07
57 0.06
58 0.06
59 0.06
60 0.06
61 0.06
62 0.08
63 0.09
64 0.09
65 0.09
66 0.16
67 0.17
68 0.24
69 0.25
70 0.3
71 0.36
72 0.38
73 0.4
74 0.37
75 0.41
76 0.44
77 0.51
78 0.5
79 0.52
80 0.59
81 0.67
82 0.74
83 0.8
84 0.81
85 0.81
86 0.81
87 0.82
88 0.79
89 0.73
90 0.67
91 0.6
92 0.5
93 0.44
94 0.47
95 0.39
96 0.33
97 0.3
98 0.27
99 0.26
100 0.26
101 0.23
102 0.18
103 0.19
104 0.2
105 0.2
106 0.2
107 0.17
108 0.2
109 0.2
110 0.19
111 0.21
112 0.22
113 0.22
114 0.23
115 0.23
116 0.22
117 0.23
118 0.2
119 0.19
120 0.17
121 0.16
122 0.15
123 0.14
124 0.11
125 0.11
126 0.1
127 0.09
128 0.1
129 0.09
130 0.09
131 0.1
132 0.1
133 0.12
134 0.12
135 0.13
136 0.13
137 0.16
138 0.17
139 0.17
140 0.17
141 0.15
142 0.16
143 0.16
144 0.18