Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4L947

Protein Details
Accession A0A3N4L947   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
123-149DLPGSQKQEKQPQKKKRKTGDEDKAGEBasic
NLS Segment(s)
PositionSequence
135-140QKKKRK
Subcellular Location(s) nucl 17.5, cyto_nucl 13.333, mito_nucl 11.332, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002775  DNA/RNA-bd_Alba-like  
Gene Ontology GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF01918  Alba  
Amino Acid Sequences MDKLTTILPAPVREVQNVNIVSTSAIVRKVDQCLSKLYPEQDPNPNPNYPEPASTPATITTSSTTTTTTTTTTITSDFPAVSITSKAATASKAITVAEIVKRCIGEKCGQWYQYTALSSVTNDLPGSQKQEKQPQKKKRKTGDEDKAGEDEEDPYALLVEKSPPKKRKVPLLTIYISRSPIPELQKLHGPLCSSEQSGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.29
3 0.34
4 0.34
5 0.3
6 0.24
7 0.22
8 0.19
9 0.18
10 0.17
11 0.11
12 0.13
13 0.13
14 0.16
15 0.19
16 0.23
17 0.27
18 0.28
19 0.27
20 0.31
21 0.33
22 0.34
23 0.35
24 0.34
25 0.36
26 0.38
27 0.41
28 0.44
29 0.46
30 0.48
31 0.48
32 0.47
33 0.42
34 0.4
35 0.41
36 0.33
37 0.31
38 0.29
39 0.29
40 0.3
41 0.28
42 0.27
43 0.22
44 0.22
45 0.19
46 0.17
47 0.14
48 0.12
49 0.13
50 0.12
51 0.12
52 0.11
53 0.12
54 0.12
55 0.11
56 0.11
57 0.11
58 0.11
59 0.11
60 0.11
61 0.11
62 0.11
63 0.1
64 0.09
65 0.08
66 0.09
67 0.08
68 0.08
69 0.08
70 0.07
71 0.07
72 0.07
73 0.07
74 0.07
75 0.07
76 0.07
77 0.07
78 0.07
79 0.08
80 0.07
81 0.07
82 0.07
83 0.08
84 0.1
85 0.1
86 0.11
87 0.11
88 0.11
89 0.12
90 0.13
91 0.14
92 0.14
93 0.16
94 0.22
95 0.25
96 0.26
97 0.25
98 0.26
99 0.25
100 0.24
101 0.22
102 0.16
103 0.13
104 0.13
105 0.12
106 0.13
107 0.11
108 0.09
109 0.08
110 0.09
111 0.1
112 0.11
113 0.17
114 0.18
115 0.23
116 0.28
117 0.38
118 0.47
119 0.56
120 0.66
121 0.7
122 0.78
123 0.83
124 0.88
125 0.88
126 0.9
127 0.88
128 0.89
129 0.88
130 0.86
131 0.8
132 0.72
133 0.63
134 0.52
135 0.43
136 0.32
137 0.23
138 0.14
139 0.11
140 0.08
141 0.07
142 0.07
143 0.07
144 0.07
145 0.06
146 0.11
147 0.19
148 0.27
149 0.37
150 0.43
151 0.5
152 0.58
153 0.64
154 0.69
155 0.71
156 0.73
157 0.71
158 0.72
159 0.69
160 0.64
161 0.63
162 0.54
163 0.47
164 0.38
165 0.32
166 0.27
167 0.29
168 0.3
169 0.32
170 0.33
171 0.34
172 0.41
173 0.44
174 0.42
175 0.39
176 0.36
177 0.32
178 0.34
179 0.34