Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4KQT6

Protein Details
Accession A0A3N4KQT6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
14-37SASRCKVICRRGRRTPRLTHNGKRHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 18.5, cyto_nucl 10.5, mito 3, cysk 3
Family & Domain DBs
Amino Acid Sequences DEYNMDEKGFIMGSASRCKVICRRGRRTPRLTHNGKRTWVTVIEAVSAAGIPLPPMIINEGAGHYQGWY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.21
4 0.21
5 0.24
6 0.29
7 0.36
8 0.42
9 0.46
10 0.54
11 0.63
12 0.73
13 0.79
14 0.81
15 0.81
16 0.82
17 0.82
18 0.81
19 0.78
20 0.76
21 0.71
22 0.66
23 0.58
24 0.49
25 0.42
26 0.34
27 0.28
28 0.21
29 0.17
30 0.15
31 0.13
32 0.12
33 0.09
34 0.08
35 0.06
36 0.04
37 0.04
38 0.03
39 0.03
40 0.04
41 0.04
42 0.05
43 0.07
44 0.07
45 0.08
46 0.09
47 0.11
48 0.11
49 0.12