Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4L1V6

Protein Details
Accession A0A3N4L1V6    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
12-32LKKIGRSLFGRKKKSKTPVEEBasic
NLS Segment(s)
PositionSequence
18-26SLFGRKKKS
Subcellular Location(s) mito 15.5, mito_nucl 10.833, cyto 6.5, cyto_nucl 6.333, nucl 5
Family & Domain DBs
Amino Acid Sequences MPGVPPNAIDALKKIGRSLFGRKKKSKTPVEETTEHGEQSNQTPPAAHDTPVNVPAVAAPPPPTTENTTTPAPQIEESREVAPTAAPAAETITPAPAPGVDGKTLFCCVRSKNPLPFSSLVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.26
4 0.3
5 0.38
6 0.42
7 0.49
8 0.59
9 0.66
10 0.71
11 0.75
12 0.81
13 0.8
14 0.78
15 0.77
16 0.76
17 0.75
18 0.7
19 0.65
20 0.61
21 0.52
22 0.43
23 0.35
24 0.26
25 0.2
26 0.21
27 0.23
28 0.17
29 0.16
30 0.16
31 0.16
32 0.23
33 0.23
34 0.21
35 0.16
36 0.17
37 0.19
38 0.2
39 0.2
40 0.12
41 0.11
42 0.11
43 0.11
44 0.09
45 0.08
46 0.08
47 0.08
48 0.1
49 0.11
50 0.12
51 0.15
52 0.18
53 0.2
54 0.22
55 0.23
56 0.22
57 0.22
58 0.21
59 0.18
60 0.16
61 0.15
62 0.14
63 0.15
64 0.17
65 0.17
66 0.16
67 0.15
68 0.14
69 0.12
70 0.1
71 0.08
72 0.06
73 0.05
74 0.05
75 0.07
76 0.07
77 0.08
78 0.08
79 0.09
80 0.08
81 0.08
82 0.08
83 0.06
84 0.08
85 0.1
86 0.12
87 0.12
88 0.13
89 0.14
90 0.16
91 0.19
92 0.18
93 0.17
94 0.19
95 0.22
96 0.32
97 0.4
98 0.45
99 0.52
100 0.6
101 0.59
102 0.62