Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4L1P6

Protein Details
Accession A0A3N4L1P6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
47-74STPTTLLQDKQRRKRRKCPLPRPTPGGLHydrophilic
NLS Segment(s)
PositionSequence
58-63RRKRRK
Subcellular Location(s) extr 8, mito 7, E.R. 5, plas 3, cyto 2
Family & Domain DBs
Amino Acid Sequences MPPAMHPKSFSTASLFTSTAVLAFLVVAAPHILPCPATGPERAESASTPTTLLQDKQRRKRRKCPLPRPTPGGLIGEVLGKKEVGAVAKEIEAFKGKKIVFEKRTGEGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.27
3 0.22
4 0.21
5 0.19
6 0.14
7 0.12
8 0.09
9 0.05
10 0.05
11 0.04
12 0.04
13 0.04
14 0.04
15 0.04
16 0.04
17 0.04
18 0.05
19 0.05
20 0.05
21 0.05
22 0.08
23 0.09
24 0.11
25 0.12
26 0.15
27 0.16
28 0.17
29 0.17
30 0.15
31 0.14
32 0.16
33 0.15
34 0.13
35 0.12
36 0.11
37 0.13
38 0.13
39 0.14
40 0.19
41 0.27
42 0.35
43 0.45
44 0.55
45 0.64
46 0.71
47 0.8
48 0.83
49 0.85
50 0.88
51 0.89
52 0.9
53 0.9
54 0.88
55 0.84
56 0.76
57 0.67
58 0.57
59 0.48
60 0.37
61 0.27
62 0.21
63 0.17
64 0.15
65 0.12
66 0.11
67 0.09
68 0.08
69 0.09
70 0.1
71 0.09
72 0.1
73 0.1
74 0.11
75 0.12
76 0.14
77 0.13
78 0.14
79 0.18
80 0.17
81 0.18
82 0.24
83 0.24
84 0.29
85 0.35
86 0.43
87 0.43
88 0.51
89 0.54