Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4K8A8

Protein Details
Accession A0A3N4K8A8    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
134-167QETCCGSKIRQHRRALRRHRRVDKVEKRGRAQLCHydrophilic
NLS Segment(s)
PositionSequence
101-109GRRGRMRLR
143-163RQHRRALRRHRRVDKVEKRGR
Subcellular Location(s) mito 13, cyto 6.5, cyto_nucl 6, nucl 4.5
Family & Domain DBs
Amino Acid Sequences MSILNLIASLSASSYPAMYTVHYRGLCNPSNMDKTVASGGGGGPSGDITAIVASVDEVLDLDGLTIDAAIRREEENDEGERDISPRMVGQGAASSSREHGGRRGRMRLRRPVQGIEIKSARNNQINTEPITKSQETCCGSKIRQHRRALRRHRRVDKVEKRGRAQLCSGC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.08
4 0.08
5 0.09
6 0.13
7 0.15
8 0.22
9 0.23
10 0.24
11 0.28
12 0.35
13 0.37
14 0.35
15 0.36
16 0.35
17 0.38
18 0.39
19 0.36
20 0.29
21 0.27
22 0.27
23 0.23
24 0.16
25 0.13
26 0.12
27 0.1
28 0.1
29 0.07
30 0.05
31 0.05
32 0.05
33 0.04
34 0.04
35 0.03
36 0.03
37 0.03
38 0.03
39 0.03
40 0.03
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.04
55 0.05
56 0.05
57 0.06
58 0.07
59 0.08
60 0.09
61 0.11
62 0.12
63 0.13
64 0.14
65 0.13
66 0.13
67 0.12
68 0.11
69 0.1
70 0.08
71 0.07
72 0.05
73 0.06
74 0.06
75 0.06
76 0.05
77 0.06
78 0.07
79 0.07
80 0.08
81 0.08
82 0.08
83 0.09
84 0.1
85 0.09
86 0.15
87 0.21
88 0.28
89 0.32
90 0.41
91 0.47
92 0.54
93 0.61
94 0.66
95 0.64
96 0.64
97 0.63
98 0.57
99 0.56
100 0.55
101 0.49
102 0.45
103 0.42
104 0.36
105 0.35
106 0.36
107 0.34
108 0.33
109 0.32
110 0.29
111 0.33
112 0.35
113 0.36
114 0.36
115 0.32
116 0.29
117 0.35
118 0.32
119 0.28
120 0.27
121 0.32
122 0.3
123 0.31
124 0.31
125 0.31
126 0.31
127 0.36
128 0.45
129 0.48
130 0.54
131 0.62
132 0.7
133 0.74
134 0.84
135 0.88
136 0.89
137 0.89
138 0.91
139 0.91
140 0.91
141 0.91
142 0.91
143 0.91
144 0.9
145 0.89
146 0.86
147 0.81
148 0.8
149 0.75
150 0.68