Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4KM93

Protein Details
Accession A0A3N4KM93    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
16-35TNTGRKAPRAPPKTPKKPVTHydrophilic
NLS Segment(s)
PositionSequence
20-67RKAPRAPPKTPKKPVTATGRITKSSPTKKKTPTPATHHKRKPSIGDKL
80-108GRPGVKAAGTKKMRGTDGKGSHRRTRSSR
Subcellular Location(s) nucl 14, mito 9, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MAYNTRSTTRATTTPTNTGRKAPRAPPKTPKKPVTATGRITKSSPTKKKTPTPATHHKRKPSIGDKLIGAAMKVEGTITGRPGVKAAGTKKMRGTDGKGSHRRTRSSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.53
3 0.55
4 0.52
5 0.55
6 0.56
7 0.56
8 0.58
9 0.58
10 0.62
11 0.62
12 0.68
13 0.71
14 0.75
15 0.78
16 0.81
17 0.78
18 0.75
19 0.72
20 0.73
21 0.72
22 0.68
23 0.62
24 0.61
25 0.58
26 0.52
27 0.48
28 0.44
29 0.44
30 0.46
31 0.49
32 0.46
33 0.51
34 0.57
35 0.64
36 0.69
37 0.7
38 0.68
39 0.68
40 0.74
41 0.75
42 0.79
43 0.78
44 0.74
45 0.7
46 0.65
47 0.65
48 0.62
49 0.62
50 0.55
51 0.51
52 0.44
53 0.4
54 0.38
55 0.29
56 0.21
57 0.12
58 0.09
59 0.07
60 0.07
61 0.05
62 0.04
63 0.06
64 0.07
65 0.08
66 0.11
67 0.12
68 0.12
69 0.13
70 0.13
71 0.13
72 0.18
73 0.2
74 0.27
75 0.29
76 0.32
77 0.37
78 0.41
79 0.43
80 0.42
81 0.45
82 0.45
83 0.52
84 0.6
85 0.64
86 0.66
87 0.71
88 0.73