Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4KVX4

Protein Details
Accession A0A3N4KVX4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
56-78GKEERDKKIKIKKANPNPSARCDBasic
NLS Segment(s)
PositionSequence
62-67KKIKIK
Subcellular Location(s) cyto 20, mito 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MIPENDLVTRPRVRVGPWYLALALALAKACCVLSYWANPGVCAPGNHSSMVGCIVGKEERDKKIKIKKANPNPSARCDIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.36
3 0.37
4 0.35
5 0.36
6 0.32
7 0.3
8 0.28
9 0.2
10 0.14
11 0.08
12 0.07
13 0.05
14 0.05
15 0.05
16 0.05
17 0.05
18 0.05
19 0.07
20 0.08
21 0.1
22 0.12
23 0.16
24 0.16
25 0.16
26 0.15
27 0.15
28 0.14
29 0.13
30 0.14
31 0.15
32 0.16
33 0.16
34 0.16
35 0.14
36 0.14
37 0.15
38 0.11
39 0.06
40 0.05
41 0.07
42 0.09
43 0.1
44 0.16
45 0.2
46 0.27
47 0.32
48 0.35
49 0.42
50 0.52
51 0.59
52 0.63
53 0.68
54 0.73
55 0.79
56 0.87
57 0.86
58 0.86
59 0.83
60 0.79