Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4KS43

Protein Details
Accession A0A3N4KS43    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
34-56GGGGGEGRRRRRRREKEEGALGNBasic
NLS Segment(s)
PositionSequence
31-74KKGGGGGGEGRRRRRRREKEEGALGNFLRPGKSTRKGRLSLKKG
Subcellular Location(s) nucl 12.5, mito 12, cyto_nucl 7.5
Family & Domain DBs
Amino Acid Sequences MTTATTNRATTYALRLQPGSSEHQREEEEEKKGGGGGGEGRRRRRRREKEEGALGNFLRPGKSTRKGRLSLKKGEEENRGREEEEEEEENGEWVEGGDMDSTDYPNNIAKVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.3
3 0.29
4 0.3
5 0.3
6 0.31
7 0.3
8 0.32
9 0.31
10 0.34
11 0.34
12 0.35
13 0.39
14 0.37
15 0.33
16 0.3
17 0.28
18 0.25
19 0.24
20 0.21
21 0.14
22 0.1
23 0.12
24 0.18
25 0.24
26 0.29
27 0.37
28 0.47
29 0.52
30 0.62
31 0.67
32 0.72
33 0.75
34 0.82
35 0.82
36 0.8
37 0.84
38 0.77
39 0.67
40 0.58
41 0.48
42 0.38
43 0.3
44 0.22
45 0.13
46 0.11
47 0.12
48 0.17
49 0.25
50 0.32
51 0.38
52 0.45
53 0.5
54 0.59
55 0.66
56 0.66
57 0.66
58 0.64
59 0.63
60 0.59
61 0.6
62 0.6
63 0.55
64 0.54
65 0.49
66 0.45
67 0.4
68 0.37
69 0.34
70 0.27
71 0.26
72 0.22
73 0.18
74 0.18
75 0.18
76 0.17
77 0.15
78 0.12
79 0.08
80 0.06
81 0.06
82 0.04
83 0.05
84 0.05
85 0.05
86 0.07
87 0.08
88 0.09
89 0.09
90 0.09
91 0.11
92 0.14