Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4L9G3

Protein Details
Accession A0A3N4L9G3    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
63-88VTKGKGFTKEKNKKKRGSYKGGAIDFHydrophilic
NLS Segment(s)
PositionSequence
66-79GKGFTKEKNKKKRG
Subcellular Location(s) nucl 16.5, cyto_nucl 12.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007718  Srp40_C  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF05022  SRP40_C  
Amino Acid Sequences NSGSSSSSVDNSTANEHNPKKPFQRVDPTKVVYVNERLKDNTFESLGFSENHYTMKAHRDLIVTKGKGFTKEKNKKKRGSYKGGAIDFTTNSFKFTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.28
3 0.31
4 0.37
5 0.4
6 0.45
7 0.47
8 0.54
9 0.56
10 0.56
11 0.63
12 0.63
13 0.67
14 0.69
15 0.65
16 0.58
17 0.54
18 0.47
19 0.39
20 0.39
21 0.37
22 0.32
23 0.31
24 0.3
25 0.3
26 0.32
27 0.3
28 0.24
29 0.18
30 0.16
31 0.15
32 0.14
33 0.14
34 0.11
35 0.11
36 0.1
37 0.1
38 0.1
39 0.1
40 0.09
41 0.1
42 0.15
43 0.16
44 0.15
45 0.17
46 0.19
47 0.19
48 0.24
49 0.31
50 0.26
51 0.26
52 0.29
53 0.28
54 0.32
55 0.34
56 0.38
57 0.41
58 0.51
59 0.61
60 0.68
61 0.75
62 0.78
63 0.85
64 0.88
65 0.86
66 0.86
67 0.83
68 0.81
69 0.81
70 0.75
71 0.65
72 0.56
73 0.49
74 0.39
75 0.36
76 0.31
77 0.22