Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4L318

Protein Details
Accession A0A3N4L318    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
147-173EVKDKKGKATKAGSKPKKRAVKLSFDQHydrophilic
NLS Segment(s)
PositionSequence
123-167KGKKRKATKIGGDDDEPAEKEKKEEVKDKKGKATKAGSKPKKRAV
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MSHKSKNLQYEMEEPAFLRRLRQQHAGGGGPDRYIAPRNKKTAVDDEEDAPAYVMEGSEVSREEFDALTSRKGAQAEGEEGAAAGEESVVPVGEESKEVVGKVKGEEEAGRVLKENVTEIGVKGKKRKATKIGGDDDEPAEKEKKEEVKDKKGKATKAGSKPKKRAVKLSFDQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.31
3 0.32
4 0.28
5 0.27
6 0.27
7 0.33
8 0.38
9 0.45
10 0.43
11 0.43
12 0.48
13 0.46
14 0.41
15 0.38
16 0.33
17 0.25
18 0.23
19 0.19
20 0.16
21 0.2
22 0.26
23 0.32
24 0.39
25 0.44
26 0.48
27 0.5
28 0.53
29 0.55
30 0.52
31 0.47
32 0.41
33 0.38
34 0.35
35 0.33
36 0.28
37 0.19
38 0.14
39 0.1
40 0.08
41 0.06
42 0.04
43 0.04
44 0.04
45 0.05
46 0.06
47 0.06
48 0.06
49 0.06
50 0.07
51 0.07
52 0.07
53 0.11
54 0.11
55 0.12
56 0.13
57 0.13
58 0.14
59 0.14
60 0.14
61 0.11
62 0.11
63 0.12
64 0.12
65 0.11
66 0.09
67 0.08
68 0.08
69 0.06
70 0.04
71 0.02
72 0.02
73 0.02
74 0.02
75 0.02
76 0.02
77 0.02
78 0.02
79 0.03
80 0.03
81 0.03
82 0.04
83 0.05
84 0.05
85 0.06
86 0.08
87 0.08
88 0.09
89 0.09
90 0.1
91 0.09
92 0.1
93 0.11
94 0.1
95 0.14
96 0.14
97 0.14
98 0.13
99 0.13
100 0.13
101 0.13
102 0.13
103 0.09
104 0.1
105 0.1
106 0.09
107 0.18
108 0.2
109 0.23
110 0.28
111 0.33
112 0.38
113 0.44
114 0.53
115 0.53
116 0.59
117 0.65
118 0.67
119 0.69
120 0.65
121 0.61
122 0.54
123 0.47
124 0.39
125 0.31
126 0.25
127 0.21
128 0.18
129 0.18
130 0.22
131 0.28
132 0.32
133 0.41
134 0.47
135 0.56
136 0.65
137 0.69
138 0.73
139 0.73
140 0.71
141 0.7
142 0.71
143 0.7
144 0.72
145 0.77
146 0.78
147 0.82
148 0.87
149 0.88
150 0.88
151 0.84
152 0.84
153 0.8
154 0.8