Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4KWN7

Protein Details
Accession A0A3N4KWN7    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
29-74AAQFWKIREKKKEKEKKEKEKKEKEKKEKKEKKEKTPTNRREREITBasic
NLS Segment(s)
PositionSequence
34-71KIREKKKEKEKKEKEKKEKEKKEKKEKKEKTPTNRRER
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MLTDGFPSYSDILLLNRTAVHLVARLIKAAQFWKIREKKKEKEKKEKEKKEKEKKEKKEKKEKTPTNRREREIT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.1
3 0.09
4 0.1
5 0.1
6 0.09
7 0.09
8 0.08
9 0.09
10 0.13
11 0.13
12 0.13
13 0.12
14 0.13
15 0.14
16 0.14
17 0.19
18 0.18
19 0.19
20 0.29
21 0.37
22 0.43
23 0.51
24 0.58
25 0.61
26 0.69
27 0.78
28 0.78
29 0.81
30 0.86
31 0.87
32 0.91
33 0.93
34 0.93
35 0.94
36 0.95
37 0.95
38 0.95
39 0.95
40 0.95
41 0.94
42 0.95
43 0.94
44 0.94
45 0.94
46 0.93
47 0.93
48 0.93
49 0.92
50 0.92
51 0.93
52 0.93
53 0.93
54 0.92