Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4L3E0

Protein Details
Accession A0A3N4L3E0   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
59-85GANANKGKGKNKGKKGKKGKNIGWKRLBasic
NLS Segment(s)
PositionSequence
62-85ANKGKGKNKGKKGKKGKNIGWKRL
Subcellular Location(s) mito 9, cyto_nucl 7.833, nucl 7.5, cyto 7, cyto_pero 5.333
Family & Domain DBs
Amino Acid Sequences MEKPEHPNDQQTESDSEFGEEMGKKPDVKVGKEKAKAAVATAAATVVQEQEQPEAPKQGANANKGKGKNKGKKGKKGKNIGWKRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.26
3 0.23
4 0.18
5 0.16
6 0.16
7 0.13
8 0.12
9 0.15
10 0.16
11 0.16
12 0.16
13 0.21
14 0.22
15 0.25
16 0.33
17 0.38
18 0.45
19 0.48
20 0.49
21 0.47
22 0.45
23 0.41
24 0.33
25 0.27
26 0.18
27 0.15
28 0.13
29 0.1
30 0.07
31 0.07
32 0.06
33 0.04
34 0.04
35 0.04
36 0.05
37 0.06
38 0.09
39 0.11
40 0.12
41 0.14
42 0.14
43 0.14
44 0.15
45 0.2
46 0.22
47 0.26
48 0.3
49 0.32
50 0.38
51 0.43
52 0.47
53 0.51
54 0.57
55 0.62
56 0.67
57 0.73
58 0.78
59 0.84
60 0.9
61 0.91
62 0.9
63 0.91
64 0.89
65 0.9