Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1V730

Protein Details
Accession K1V730   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
135-159GATVQHERRKKEKRKSDVARDDVQAHydrophilic
NLS Segment(s)
PositionSequence
142-150RRKKEKRKS
Subcellular Location(s) nucl 15.5, mito_nucl 11, cyto 6, mito 5.5
Family & Domain DBs
Amino Acid Sequences MAATSTSTSKTDGESRPIRVTTGGHVVKYAERVIALLEAGSPAILTTQLSTEPKANSTLHPATLAIPRLISVAEKVKREWLKTHDEVWQYNVSGNMKSQERPSLERVLSGKTKPKMAHNPYLEITLSGSELDLEGATVQHERRKKEKRKSDVARDDVQAKRARLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.41
3 0.44
4 0.44
5 0.42
6 0.36
7 0.34
8 0.29
9 0.33
10 0.3
11 0.25
12 0.25
13 0.26
14 0.25
15 0.26
16 0.23
17 0.14
18 0.12
19 0.12
20 0.12
21 0.11
22 0.09
23 0.06
24 0.06
25 0.05
26 0.05
27 0.05
28 0.04
29 0.03
30 0.03
31 0.04
32 0.04
33 0.04
34 0.05
35 0.08
36 0.09
37 0.11
38 0.14
39 0.14
40 0.15
41 0.18
42 0.19
43 0.17
44 0.23
45 0.23
46 0.2
47 0.2
48 0.19
49 0.18
50 0.2
51 0.21
52 0.13
53 0.12
54 0.11
55 0.11
56 0.11
57 0.09
58 0.08
59 0.13
60 0.17
61 0.18
62 0.18
63 0.25
64 0.28
65 0.29
66 0.31
67 0.29
68 0.33
69 0.34
70 0.36
71 0.34
72 0.34
73 0.32
74 0.32
75 0.28
76 0.21
77 0.2
78 0.2
79 0.15
80 0.13
81 0.13
82 0.14
83 0.14
84 0.15
85 0.16
86 0.19
87 0.21
88 0.24
89 0.28
90 0.31
91 0.29
92 0.31
93 0.31
94 0.3
95 0.31
96 0.3
97 0.34
98 0.3
99 0.35
100 0.34
101 0.41
102 0.47
103 0.5
104 0.57
105 0.52
106 0.54
107 0.5
108 0.5
109 0.42
110 0.31
111 0.25
112 0.16
113 0.14
114 0.09
115 0.08
116 0.06
117 0.06
118 0.06
119 0.05
120 0.04
121 0.04
122 0.04
123 0.05
124 0.08
125 0.09
126 0.15
127 0.2
128 0.26
129 0.36
130 0.47
131 0.57
132 0.65
133 0.75
134 0.78
135 0.85
136 0.9
137 0.91
138 0.91
139 0.87
140 0.81
141 0.74
142 0.72
143 0.64
144 0.61
145 0.56