Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4KCE7

Protein Details
Accession A0A3N4KCE7   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
43-71STNIQHHKRTKQEEKKEQKKGQNQQHTHTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MNLMRRDDGHGGINFIYSSSPPPRSLQTATTHTPNHNLKQSTSTNIQHHKRTKQEEKKEQKKGQNQQHTHTHTTETYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.16
3 0.14
4 0.09
5 0.13
6 0.16
7 0.18
8 0.2
9 0.22
10 0.24
11 0.28
12 0.3
13 0.29
14 0.3
15 0.33
16 0.33
17 0.36
18 0.35
19 0.31
20 0.36
21 0.35
22 0.33
23 0.34
24 0.33
25 0.29
26 0.33
27 0.33
28 0.3
29 0.31
30 0.33
31 0.32
32 0.4
33 0.44
34 0.46
35 0.52
36 0.55
37 0.58
38 0.62
39 0.68
40 0.7
41 0.77
42 0.79
43 0.84
44 0.87
45 0.9
46 0.89
47 0.88
48 0.87
49 0.87
50 0.87
51 0.86
52 0.81
53 0.77
54 0.78
55 0.75
56 0.7
57 0.61
58 0.55