Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4KXD0

Protein Details
Accession A0A3N4KXD0    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MRWPLILRRERKKERKKEGRIRDGALIBasic
NLS Segment(s)
PositionSequence
8-21RRERKKERKKEGRI
Subcellular Location(s) mito 19, cyto_nucl 4, nucl 3, cyto 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MRWPLILRRERKKERKKEGRIRDGALILSHVEGQDLSCVFVFCQFQLPFPLVLSGCTIYHYPYYRYYYYYYYVLFDHLYSPLLLLISP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.93
3 0.94
4 0.94
5 0.94
6 0.94
7 0.88
8 0.8
9 0.73
10 0.63
11 0.52
12 0.41
13 0.31
14 0.2
15 0.15
16 0.12
17 0.08
18 0.07
19 0.06
20 0.06
21 0.07
22 0.06
23 0.06
24 0.06
25 0.06
26 0.06
27 0.09
28 0.09
29 0.07
30 0.14
31 0.13
32 0.14
33 0.15
34 0.16
35 0.14
36 0.14
37 0.15
38 0.09
39 0.09
40 0.1
41 0.1
42 0.09
43 0.1
44 0.1
45 0.1
46 0.14
47 0.15
48 0.16
49 0.2
50 0.26
51 0.25
52 0.28
53 0.29
54 0.29
55 0.3
56 0.3
57 0.26
58 0.22
59 0.21
60 0.2
61 0.18
62 0.16
63 0.14
64 0.12
65 0.12
66 0.11
67 0.11
68 0.1