Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4KY87

Protein Details
Accession A0A3N4KY87    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
78-98SIIQQGKKKSGRKKNCHDTLPHydrophilic
141-162PVINHCGLFHRKKERKRNRNRSBasic
NLS Segment(s)
PositionSequence
85-90KKSGRK
151-162RKKERKRNRNRS
Subcellular Location(s) mito 13, extr 5, nucl 4.5, cyto_nucl 4, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MWCVWPAWAAWPWLNSATVGTLPVVQGVTPRNLHVQIVEPVDYTLIQPSCRVDCDPLYTSHTDQTCLLACWRPLHDGSIIQQGKKKSGRKKNCHDTLPLHLPPPLPSHLPLACVTRIWGACESGSPHFYFYFSGGRGGRAPVINHCGLFHRKKERKRNRNRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.18
3 0.16
4 0.15
5 0.13
6 0.12
7 0.1
8 0.1
9 0.09
10 0.1
11 0.09
12 0.08
13 0.1
14 0.12
15 0.16
16 0.16
17 0.17
18 0.2
19 0.21
20 0.21
21 0.19
22 0.2
23 0.2
24 0.21
25 0.2
26 0.17
27 0.16
28 0.16
29 0.15
30 0.12
31 0.13
32 0.11
33 0.11
34 0.12
35 0.14
36 0.15
37 0.16
38 0.17
39 0.15
40 0.15
41 0.2
42 0.21
43 0.21
44 0.23
45 0.24
46 0.24
47 0.26
48 0.25
49 0.21
50 0.19
51 0.19
52 0.16
53 0.14
54 0.15
55 0.13
56 0.14
57 0.15
58 0.16
59 0.16
60 0.15
61 0.16
62 0.15
63 0.14
64 0.15
65 0.22
66 0.22
67 0.2
68 0.23
69 0.22
70 0.27
71 0.33
72 0.38
73 0.38
74 0.48
75 0.59
76 0.66
77 0.75
78 0.8
79 0.81
80 0.77
81 0.72
82 0.65
83 0.61
84 0.59
85 0.5
86 0.4
87 0.34
88 0.32
89 0.29
90 0.29
91 0.23
92 0.17
93 0.17
94 0.21
95 0.19
96 0.21
97 0.21
98 0.21
99 0.19
100 0.17
101 0.17
102 0.17
103 0.17
104 0.17
105 0.17
106 0.15
107 0.14
108 0.16
109 0.18
110 0.16
111 0.18
112 0.16
113 0.17
114 0.16
115 0.16
116 0.16
117 0.15
118 0.17
119 0.15
120 0.21
121 0.19
122 0.21
123 0.22
124 0.23
125 0.24
126 0.23
127 0.24
128 0.23
129 0.29
130 0.28
131 0.28
132 0.27
133 0.29
134 0.34
135 0.39
136 0.42
137 0.48
138 0.55
139 0.66
140 0.76
141 0.82
142 0.85