Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4L3Z3

Protein Details
Accession A0A3N4L3Z3   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
71-100LERDRLSRRLASRRRRRRRRCRGSGMSGSLBasic
NLS Segment(s)
PositionSequence
75-91RLSRRLASRRRRRRRRC
Subcellular Location(s) mito 11, nucl 8.5, cyto_nucl 7, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MMSTSTKAALQNAIKTSVRRILHFTGPHSKLKDIFEDVSDDILHFVRFPATRVQVSNMFYQLLDSGGIPHLERDRLSRRLASRRRRRRRRCRGSGMSGSLASPPPPPLLPPPPPPPPHPHSHSTCSSTASHPDTTIPLAEQRSLLSALHRACLYACFTFCKHTLRLDITRNIDDPVASQVCLSALIEAIIAAYNSGTLAPELIDEDAGFGPGNAFERAGCVVDAVVWRGPMGDRRLLSVLQAGEEIVAALRDEERVGRVDALYRRAERLIREAAGVEAKGEEKEWVEETTDDEDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.36
3 0.4
4 0.4
5 0.39
6 0.35
7 0.39
8 0.38
9 0.44
10 0.46
11 0.47
12 0.5
13 0.52
14 0.56
15 0.52
16 0.5
17 0.46
18 0.45
19 0.45
20 0.39
21 0.36
22 0.31
23 0.32
24 0.29
25 0.26
26 0.23
27 0.18
28 0.15
29 0.14
30 0.12
31 0.09
32 0.09
33 0.12
34 0.12
35 0.14
36 0.2
37 0.24
38 0.26
39 0.28
40 0.32
41 0.32
42 0.34
43 0.35
44 0.29
45 0.25
46 0.22
47 0.21
48 0.17
49 0.12
50 0.1
51 0.08
52 0.08
53 0.08
54 0.09
55 0.09
56 0.11
57 0.12
58 0.14
59 0.14
60 0.19
61 0.25
62 0.28
63 0.31
64 0.35
65 0.4
66 0.49
67 0.58
68 0.63
69 0.67
70 0.74
71 0.83
72 0.88
73 0.93
74 0.94
75 0.96
76 0.96
77 0.96
78 0.95
79 0.93
80 0.9
81 0.86
82 0.78
83 0.69
84 0.58
85 0.47
86 0.38
87 0.29
88 0.21
89 0.15
90 0.12
91 0.11
92 0.11
93 0.12
94 0.16
95 0.22
96 0.26
97 0.31
98 0.36
99 0.42
100 0.45
101 0.47
102 0.49
103 0.47
104 0.49
105 0.48
106 0.48
107 0.45
108 0.48
109 0.48
110 0.45
111 0.41
112 0.38
113 0.34
114 0.29
115 0.28
116 0.26
117 0.23
118 0.19
119 0.19
120 0.17
121 0.16
122 0.14
123 0.1
124 0.1
125 0.1
126 0.1
127 0.1
128 0.09
129 0.1
130 0.1
131 0.1
132 0.08
133 0.11
134 0.11
135 0.12
136 0.12
137 0.11
138 0.1
139 0.11
140 0.13
141 0.1
142 0.1
143 0.11
144 0.12
145 0.14
146 0.16
147 0.18
148 0.17
149 0.18
150 0.22
151 0.24
152 0.29
153 0.31
154 0.35
155 0.34
156 0.35
157 0.33
158 0.3
159 0.25
160 0.2
161 0.16
162 0.16
163 0.13
164 0.11
165 0.1
166 0.1
167 0.1
168 0.1
169 0.09
170 0.05
171 0.04
172 0.04
173 0.04
174 0.04
175 0.04
176 0.03
177 0.03
178 0.03
179 0.03
180 0.03
181 0.03
182 0.03
183 0.03
184 0.03
185 0.03
186 0.03
187 0.04
188 0.05
189 0.05
190 0.05
191 0.04
192 0.06
193 0.06
194 0.06
195 0.06
196 0.05
197 0.05
198 0.06
199 0.08
200 0.07
201 0.07
202 0.07
203 0.08
204 0.09
205 0.1
206 0.09
207 0.07
208 0.07
209 0.08
210 0.09
211 0.1
212 0.1
213 0.09
214 0.09
215 0.09
216 0.11
217 0.15
218 0.18
219 0.21
220 0.2
221 0.24
222 0.26
223 0.25
224 0.25
225 0.24
226 0.2
227 0.15
228 0.15
229 0.12
230 0.1
231 0.1
232 0.09
233 0.05
234 0.05
235 0.04
236 0.05
237 0.05
238 0.05
239 0.06
240 0.07
241 0.09
242 0.11
243 0.12
244 0.13
245 0.13
246 0.2
247 0.23
248 0.27
249 0.32
250 0.31
251 0.33
252 0.35
253 0.37
254 0.34
255 0.36
256 0.37
257 0.32
258 0.31
259 0.29
260 0.28
261 0.28
262 0.24
263 0.19
264 0.14
265 0.14
266 0.14
267 0.14
268 0.13
269 0.12
270 0.15
271 0.16
272 0.16
273 0.17
274 0.17
275 0.2