Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4KJU7

Protein Details
Accession A0A3N4KJU7    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
80-122PLDLRTKKTRAIRRRLTKHESRLKTVKESKKALHFPKRKYAIKBasic
NLS Segment(s)
PositionSequence
84-123RTKKTRAIRRRLTKHESRLKTVKESKKALHFPKRKYAIKA
Subcellular Location(s) nucl 19, cyto_nucl 12, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MPGVKTGTLWKKSKTDLQKQLDELKLELSNLRVQKITSGASSKLTKIHDVRKSVARVLTVINATQRQQLRIFYKGKKYLPLDLRTKKTRAIRRRLTKHESRLKTVKESKKALHFPKRKYAIKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.62
3 0.65
4 0.68
5 0.69
6 0.68
7 0.71
8 0.65
9 0.56
10 0.46
11 0.39
12 0.32
13 0.26
14 0.23
15 0.17
16 0.19
17 0.19
18 0.2
19 0.18
20 0.17
21 0.18
22 0.2
23 0.19
24 0.15
25 0.17
26 0.16
27 0.2
28 0.21
29 0.2
30 0.22
31 0.22
32 0.25
33 0.27
34 0.34
35 0.36
36 0.38
37 0.4
38 0.42
39 0.42
40 0.4
41 0.37
42 0.28
43 0.24
44 0.21
45 0.2
46 0.14
47 0.13
48 0.12
49 0.11
50 0.12
51 0.16
52 0.16
53 0.16
54 0.17
55 0.21
56 0.23
57 0.28
58 0.33
59 0.33
60 0.4
61 0.45
62 0.45
63 0.47
64 0.47
65 0.49
66 0.51
67 0.53
68 0.54
69 0.55
70 0.61
71 0.59
72 0.58
73 0.56
74 0.58
75 0.61
76 0.62
77 0.65
78 0.69
79 0.74
80 0.82
81 0.85
82 0.85
83 0.84
84 0.85
85 0.85
86 0.79
87 0.76
88 0.75
89 0.7
90 0.71
91 0.72
92 0.71
93 0.69
94 0.7
95 0.68
96 0.7
97 0.75
98 0.76
99 0.77
100 0.76
101 0.74
102 0.79
103 0.82