Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4KWH8

Protein Details
Accession A0A3N4KWH8    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MQKKEQNKPKRVKKPYDIKKADLBasic
NLS Segment(s)
PositionSequence
8-14KPKRVKK
Subcellular Location(s) nucl 16, cyto 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR039159  SAYSD1  
IPR019387  SAYSvFN_dom  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF10260  SAYSvFN  
Amino Acid Sequences MQKKEQNKPKRVKKPYDIKKADLDLAGYRKELADRSPAHLFQRAITSLRASRQFHLYLLLQAIAAFYGYGQFMFCIGILWMCYVNTGTRKDGEKSAYSVFNKNVEAIDGATNLEYLDREIRRQIY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.91
3 0.92
4 0.86
5 0.79
6 0.76
7 0.69
8 0.61
9 0.51
10 0.42
11 0.36
12 0.33
13 0.3
14 0.23
15 0.2
16 0.18
17 0.18
18 0.17
19 0.14
20 0.19
21 0.19
22 0.24
23 0.28
24 0.29
25 0.3
26 0.34
27 0.33
28 0.26
29 0.28
30 0.25
31 0.22
32 0.21
33 0.21
34 0.18
35 0.22
36 0.27
37 0.25
38 0.25
39 0.28
40 0.28
41 0.25
42 0.26
43 0.22
44 0.16
45 0.15
46 0.13
47 0.09
48 0.08
49 0.08
50 0.05
51 0.04
52 0.03
53 0.02
54 0.03
55 0.03
56 0.03
57 0.03
58 0.03
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.04
65 0.05
66 0.05
67 0.05
68 0.05
69 0.06
70 0.06
71 0.08
72 0.12
73 0.14
74 0.16
75 0.19
76 0.22
77 0.24
78 0.27
79 0.29
80 0.27
81 0.28
82 0.3
83 0.33
84 0.33
85 0.35
86 0.33
87 0.33
88 0.31
89 0.29
90 0.26
91 0.2
92 0.18
93 0.16
94 0.15
95 0.12
96 0.11
97 0.11
98 0.1
99 0.09
100 0.09
101 0.07
102 0.08
103 0.15
104 0.16
105 0.19