Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K1VCL8

Protein Details
Accession K1VCL8    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
41-60EPAPKPAKGKRKATNPSKPAHydrophilic
NLS Segment(s)
PositionSequence
44-54PKPAKGKRKAT
Subcellular Location(s) nucl 25, cyto_nucl 15.5
Family & Domain DBs
Amino Acid Sequences MLTRRKSQPSPPPPPEHDELDDTKSDLTELDIKSESDQTPEPAPKPAKGKRKATNPSKPASSGTVQHRGSTRTDTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.68
3 0.62
4 0.54
5 0.48
6 0.43
7 0.38
8 0.33
9 0.28
10 0.24
11 0.19
12 0.16
13 0.11
14 0.1
15 0.12
16 0.12
17 0.14
18 0.14
19 0.15
20 0.16
21 0.18
22 0.16
23 0.13
24 0.13
25 0.13
26 0.15
27 0.17
28 0.17
29 0.2
30 0.22
31 0.23
32 0.31
33 0.37
34 0.44
35 0.51
36 0.59
37 0.61
38 0.7
39 0.77
40 0.79
41 0.82
42 0.77
43 0.74
44 0.68
45 0.62
46 0.54
47 0.49
48 0.41
49 0.38
50 0.39
51 0.43
52 0.41
53 0.42
54 0.43
55 0.4
56 0.41