Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4L6W8

Protein Details
Accession A0A3N4L6W8   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
35-60STGDGRSRKKKDPSRRLTRKNPMSIIHydrophilic
NLS Segment(s)
PositionSequence
30-54RERKESTGDGRSRKKKDPSRRLTRK
Subcellular Location(s) nucl 23, cyto_nucl 13.833, mito_nucl 12.333
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLPYPRTDRSPQDSRGHLKIHQLNEQERSRERKESTGDGRSRKKKDPSRRLTRKNPMSIINISFFFSFSVTSVMRLRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.61
3 0.56
4 0.5
5 0.51
6 0.5
7 0.47
8 0.47
9 0.46
10 0.44
11 0.48
12 0.49
13 0.44
14 0.42
15 0.45
16 0.42
17 0.43
18 0.42
19 0.4
20 0.4
21 0.43
22 0.44
23 0.46
24 0.47
25 0.48
26 0.55
27 0.58
28 0.6
29 0.6
30 0.64
31 0.65
32 0.72
33 0.76
34 0.78
35 0.81
36 0.87
37 0.89
38 0.9
39 0.91
40 0.89
41 0.84
42 0.78
43 0.71
44 0.65
45 0.59
46 0.52
47 0.43
48 0.35
49 0.3
50 0.26
51 0.22
52 0.17
53 0.14
54 0.11
55 0.09
56 0.13
57 0.11
58 0.14