Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4K8F8

Protein Details
Accession A0A3N4K8F8    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
105-130ASIGALRCRWRQRQRKRWRRRWRCSAHydrophilic
NLS Segment(s)
PositionSequence
115-126RQRQRKRWRRRW
Subcellular Location(s) nucl 11, extr 7, mito 5, cyto 4
Family & Domain DBs
Amino Acid Sequences MICWQRGGGASPGYECVGCGGGKSKSTDSLYRTLSPWVTGCHSHSTGHGISLAFRVTGYHSPYPCSLMQFGAAAGASVGGGGGDSGRGISLRAAGAASAGVDLGASIGALRCRWRQRQRKRWRRRWRCSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.15
3 0.12
4 0.12
5 0.11
6 0.1
7 0.13
8 0.14
9 0.17
10 0.2
11 0.2
12 0.24
13 0.28
14 0.32
15 0.31
16 0.35
17 0.37
18 0.35
19 0.35
20 0.32
21 0.29
22 0.26
23 0.23
24 0.2
25 0.18
26 0.18
27 0.2
28 0.22
29 0.23
30 0.22
31 0.21
32 0.23
33 0.21
34 0.19
35 0.19
36 0.13
37 0.13
38 0.13
39 0.12
40 0.08
41 0.07
42 0.07
43 0.08
44 0.11
45 0.15
46 0.18
47 0.18
48 0.2
49 0.2
50 0.23
51 0.21
52 0.19
53 0.15
54 0.12
55 0.12
56 0.1
57 0.1
58 0.07
59 0.06
60 0.05
61 0.04
62 0.04
63 0.03
64 0.02
65 0.02
66 0.02
67 0.02
68 0.02
69 0.02
70 0.02
71 0.02
72 0.02
73 0.02
74 0.03
75 0.03
76 0.04
77 0.05
78 0.05
79 0.06
80 0.06
81 0.06
82 0.06
83 0.05
84 0.05
85 0.04
86 0.03
87 0.03
88 0.03
89 0.03
90 0.03
91 0.02
92 0.02
93 0.03
94 0.04
95 0.05
96 0.07
97 0.11
98 0.18
99 0.26
100 0.37
101 0.48
102 0.58
103 0.68
104 0.79
105 0.86
106 0.91
107 0.94
108 0.95
109 0.96
110 0.96