Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4L4C8

Protein Details
Accession A0A3N4L4C8    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
54-89ISTMPQKEPKNQSNKNKKQKQKQKLERNNKNQETLTHydrophilic
NLS Segment(s)
PositionSequence
68-75KNKKQKQK
Subcellular Location(s) mito 16.5, mito_nucl 12.166, nucl 6.5, cyto_nucl 5.333
Family & Domain DBs
Amino Acid Sequences MTFNEFTYHGNLFMRPTMSRPMWLCFHSRALYASVLSQLSLPQPLRWSDIPFTISTMPQKEPKNQSNKNKKQKQKQKLERNNKNQETLTLPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.17
3 0.19
4 0.24
5 0.24
6 0.28
7 0.28
8 0.29
9 0.3
10 0.31
11 0.32
12 0.28
13 0.31
14 0.27
15 0.26
16 0.23
17 0.22
18 0.21
19 0.18
20 0.15
21 0.13
22 0.11
23 0.11
24 0.09
25 0.08
26 0.08
27 0.11
28 0.11
29 0.1
30 0.11
31 0.12
32 0.16
33 0.16
34 0.18
35 0.16
36 0.17
37 0.18
38 0.17
39 0.18
40 0.15
41 0.15
42 0.16
43 0.17
44 0.18
45 0.23
46 0.26
47 0.32
48 0.39
49 0.46
50 0.54
51 0.6
52 0.68
53 0.74
54 0.81
55 0.85
56 0.87
57 0.89
58 0.9
59 0.92
60 0.92
61 0.92
62 0.92
63 0.92
64 0.94
65 0.95
66 0.95
67 0.95
68 0.95
69 0.89
70 0.84
71 0.74
72 0.66