Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4KN88

Protein Details
Accession A0A3N4KN88    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
55-81FQAYRDCKKKWIEERKEEKRRQTKMSLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 3, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MPVTYTENPTDPKVTAKFNNKASSQYFDPCQEAANRSLKCLHRNPGDKDMCTDYFQAYRDCKKKWIEERKEEKRRQTKMSLW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.37
3 0.43
4 0.47
5 0.51
6 0.57
7 0.52
8 0.53
9 0.5
10 0.47
11 0.41
12 0.37
13 0.33
14 0.29
15 0.29
16 0.25
17 0.23
18 0.2
19 0.2
20 0.21
21 0.26
22 0.23
23 0.23
24 0.29
25 0.3
26 0.34
27 0.36
28 0.38
29 0.38
30 0.45
31 0.49
32 0.53
33 0.53
34 0.48
35 0.46
36 0.45
37 0.39
38 0.34
39 0.3
40 0.21
41 0.21
42 0.22
43 0.23
44 0.23
45 0.3
46 0.34
47 0.35
48 0.4
49 0.44
50 0.52
51 0.59
52 0.66
53 0.67
54 0.73
55 0.82
56 0.86
57 0.91
58 0.89
59 0.89
60 0.88
61 0.85
62 0.82