Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4KIV7

Protein Details
Accession A0A3N4KIV7   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
12-49LRGGDFPRKEKRGRKKKVDKYTEKKRKKKEVMFWSFSPBasic
NLS Segment(s)
PositionSequence
18-40PRKEKRGRKKKVDKYTEKKRKKK
Subcellular Location(s) nucl 17, cyto 7, mito 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MDLGRDPRDLSLRGGDFPRKEKRGRKKKVDKYTEKKRKKKEVMFWSFSPFQDTHIFFAPSIYYGALLFLGSHKSRRCRYGNGVKQHGQTETPMGTEPMEENTIP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.36
3 0.36
4 0.42
5 0.48
6 0.47
7 0.53
8 0.6
9 0.67
10 0.72
11 0.79
12 0.83
13 0.84
14 0.89
15 0.92
16 0.93
17 0.93
18 0.92
19 0.93
20 0.93
21 0.92
22 0.91
23 0.9
24 0.9
25 0.89
26 0.88
27 0.86
28 0.86
29 0.85
30 0.81
31 0.72
32 0.67
33 0.58
34 0.49
35 0.43
36 0.31
37 0.25
38 0.25
39 0.24
40 0.2
41 0.2
42 0.21
43 0.17
44 0.17
45 0.14
46 0.1
47 0.1
48 0.08
49 0.06
50 0.05
51 0.06
52 0.05
53 0.05
54 0.04
55 0.05
56 0.09
57 0.09
58 0.14
59 0.18
60 0.26
61 0.3
62 0.37
63 0.41
64 0.44
65 0.54
66 0.61
67 0.65
68 0.68
69 0.72
70 0.69
71 0.68
72 0.63
73 0.55
74 0.45
75 0.37
76 0.32
77 0.25
78 0.21
79 0.19
80 0.17
81 0.15
82 0.15
83 0.15
84 0.14