Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4KD72

Protein Details
Accession A0A3N4KD72    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
38-60EMVFACKKCKKCFRKDTSVWDERHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16.5, cyto_mito 10, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR008913  Znf_CHY  
IPR037274  Znf_CHY_sf  
Gene Ontology GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF05495  zf-CHY  
PROSITE View protein in PROSITE  
PS51266  ZF_CHY  
Amino Acid Sequences KHVLNAQVSIRSPCCQKWFDCAECHAEAEEHRLLQRIEMVFACKKCKKCFRKDTSVWDER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.32
3 0.31
4 0.35
5 0.39
6 0.4
7 0.39
8 0.37
9 0.36
10 0.34
11 0.33
12 0.25
13 0.19
14 0.16
15 0.18
16 0.16
17 0.11
18 0.11
19 0.13
20 0.12
21 0.12
22 0.15
23 0.11
24 0.12
25 0.12
26 0.16
27 0.19
28 0.21
29 0.28
30 0.3
31 0.36
32 0.44
33 0.54
34 0.6
35 0.67
36 0.76
37 0.78
38 0.83
39 0.85
40 0.87