Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E2M288

Protein Details
Accession E2M288    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
43-64ANFKRRVPPRLPKPRKRDIPDTBasic
NLS Segment(s)
PositionSequence
46-59KRRVPPRLPKPRKR
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, pero 3, cyto 2.5
Family & Domain DBs
KEGG mpr:MPER_14078  -  
Amino Acid Sequences QLNIYGFMRKVNLRNVDPAIDDPDASTWSHPTLNRHSPPEVVANFKRRVPPRLPKPRKRDIPDTQQLIPPPRPPPSPTPIVGRARGFSAPGAFAPAWATTTRQGTSGIPPLTVPPDPPSHHYDDSPTSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.44
3 0.42
4 0.39
5 0.36
6 0.32
7 0.25
8 0.23
9 0.18
10 0.16
11 0.16
12 0.14
13 0.14
14 0.1
15 0.11
16 0.15
17 0.17
18 0.21
19 0.28
20 0.37
21 0.4
22 0.43
23 0.43
24 0.4
25 0.4
26 0.41
27 0.34
28 0.32
29 0.32
30 0.35
31 0.36
32 0.37
33 0.43
34 0.39
35 0.44
36 0.45
37 0.51
38 0.55
39 0.65
40 0.73
41 0.75
42 0.8
43 0.84
44 0.85
45 0.81
46 0.8
47 0.75
48 0.75
49 0.73
50 0.68
51 0.6
52 0.52
53 0.48
54 0.42
55 0.37
56 0.3
57 0.26
58 0.25
59 0.26
60 0.27
61 0.31
62 0.32
63 0.34
64 0.32
65 0.35
66 0.39
67 0.41
68 0.42
69 0.37
70 0.33
71 0.31
72 0.29
73 0.24
74 0.17
75 0.15
76 0.12
77 0.1
78 0.14
79 0.11
80 0.11
81 0.12
82 0.11
83 0.11
84 0.11
85 0.13
86 0.12
87 0.16
88 0.16
89 0.16
90 0.17
91 0.18
92 0.22
93 0.28
94 0.25
95 0.22
96 0.22
97 0.23
98 0.26
99 0.25
100 0.22
101 0.18
102 0.24
103 0.27
104 0.31
105 0.35
106 0.38
107 0.4
108 0.39
109 0.41