Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4KNS7

Protein Details
Accession A0A3N4KNS7   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
89-127DPSHRVRKRRVGFLARKRTRGGRAVLKRRQLKGRRSLSHBasic
NLS Segment(s)
PositionSequence
92-125HRVRKRRVGFLARKRTRGGRAVLKRRQLKGRRSL
Subcellular Location(s) mito 19, nucl 5.5, cyto_nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MLCTRGITRAIRPMTSLPLKSLFKTLPARTFTSLTPLRPSIFPSISSGLAVPTNITSITAATTTIAPRISSHPALQALQVRNGPRNTFDPSHRVRKRRVGFLARKRTRGGRAVLKRRQLKGRRSLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.38
4 0.32
5 0.36
6 0.37
7 0.35
8 0.38
9 0.3
10 0.31
11 0.37
12 0.39
13 0.39
14 0.41
15 0.43
16 0.41
17 0.43
18 0.36
19 0.36
20 0.35
21 0.3
22 0.3
23 0.28
24 0.27
25 0.26
26 0.29
27 0.26
28 0.24
29 0.23
30 0.22
31 0.23
32 0.21
33 0.21
34 0.18
35 0.13
36 0.12
37 0.11
38 0.08
39 0.05
40 0.06
41 0.05
42 0.05
43 0.05
44 0.05
45 0.05
46 0.05
47 0.05
48 0.05
49 0.06
50 0.06
51 0.07
52 0.07
53 0.07
54 0.08
55 0.11
56 0.14
57 0.15
58 0.15
59 0.17
60 0.18
61 0.18
62 0.19
63 0.22
64 0.19
65 0.21
66 0.23
67 0.22
68 0.26
69 0.27
70 0.26
71 0.23
72 0.25
73 0.28
74 0.28
75 0.3
76 0.33
77 0.37
78 0.47
79 0.52
80 0.55
81 0.56
82 0.63
83 0.67
84 0.68
85 0.71
86 0.71
87 0.74
88 0.79
89 0.84
90 0.79
91 0.77
92 0.72
93 0.7
94 0.65
95 0.61
96 0.58
97 0.58
98 0.62
99 0.69
100 0.73
101 0.76
102 0.77
103 0.78
104 0.81
105 0.79
106 0.78
107 0.78