Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4KE68

Protein Details
Accession A0A3N4KE68    Localization Confidence High Confidence Score 17.3
NoLS Segment(s)
PositionSequenceProtein Nature
33-61YRNPPVQTASRQRPKAKPKTNPRPRSSIPHydrophilic
NLS Segment(s)
PositionSequence
45-56RPKAKPKTNPRP
333-333R
335-337GGR
Subcellular Location(s) nucl 19.5, cyto_nucl 13, mito 4
Family & Domain DBs
Amino Acid Sequences MGCCCSTEYDQYAAQSRRLATNPAVVNTTNYPYRNPPVQTASRQRPKAKPKTNPRPRSSIPGSIITSVNELNWPALEPLPERPDTQRGRPTRFLSVLSVNPREELGEIPETATPVLPPDGIYYEGYAPPLPDRVPQDPHPDRMAREPPPIPPKEKEAVLAGDEHGIAYAPAVPPKPDQIRGEAIPAPLAKDLHSVFAELSSQRRVAELAGPPPPAELDDTLVPNPVHEEVRMQYRDAVPYAPNFSELPAQVLPISPSGPLYSPHLVGSEMNQGLQPRIASPRHADSIHKEMDAAGATYELDYRQRSPHRQVVESLIPSSVPATDPRSRYVRRRTGGRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.34
3 0.33
4 0.35
5 0.36
6 0.37
7 0.31
8 0.37
9 0.38
10 0.35
11 0.36
12 0.3
13 0.32
14 0.3
15 0.32
16 0.29
17 0.27
18 0.29
19 0.32
20 0.38
21 0.41
22 0.41
23 0.42
24 0.45
25 0.51
26 0.56
27 0.61
28 0.66
29 0.68
30 0.74
31 0.76
32 0.78
33 0.82
34 0.84
35 0.84
36 0.84
37 0.86
38 0.89
39 0.92
40 0.93
41 0.87
42 0.85
43 0.79
44 0.78
45 0.72
46 0.69
47 0.62
48 0.57
49 0.54
50 0.47
51 0.44
52 0.35
53 0.31
54 0.22
55 0.19
56 0.14
57 0.12
58 0.1
59 0.1
60 0.1
61 0.09
62 0.1
63 0.11
64 0.12
65 0.17
66 0.21
67 0.22
68 0.23
69 0.25
70 0.33
71 0.36
72 0.42
73 0.46
74 0.48
75 0.54
76 0.6
77 0.6
78 0.57
79 0.55
80 0.49
81 0.44
82 0.41
83 0.39
84 0.37
85 0.37
86 0.3
87 0.29
88 0.27
89 0.24
90 0.2
91 0.16
92 0.14
93 0.12
94 0.12
95 0.12
96 0.13
97 0.13
98 0.12
99 0.11
100 0.07
101 0.07
102 0.07
103 0.07
104 0.07
105 0.07
106 0.08
107 0.1
108 0.1
109 0.1
110 0.11
111 0.11
112 0.12
113 0.11
114 0.1
115 0.09
116 0.11
117 0.1
118 0.12
119 0.16
120 0.19
121 0.23
122 0.26
123 0.36
124 0.37
125 0.4
126 0.4
127 0.38
128 0.35
129 0.37
130 0.4
131 0.33
132 0.35
133 0.33
134 0.35
135 0.42
136 0.43
137 0.41
138 0.37
139 0.39
140 0.36
141 0.35
142 0.3
143 0.24
144 0.22
145 0.19
146 0.18
147 0.13
148 0.1
149 0.1
150 0.08
151 0.06
152 0.05
153 0.04
154 0.03
155 0.05
156 0.04
157 0.06
158 0.07
159 0.08
160 0.08
161 0.14
162 0.16
163 0.19
164 0.2
165 0.22
166 0.25
167 0.25
168 0.28
169 0.24
170 0.22
171 0.19
172 0.18
173 0.15
174 0.13
175 0.13
176 0.1
177 0.11
178 0.11
179 0.12
180 0.12
181 0.11
182 0.1
183 0.1
184 0.11
185 0.09
186 0.11
187 0.1
188 0.11
189 0.1
190 0.11
191 0.11
192 0.1
193 0.14
194 0.15
195 0.17
196 0.19
197 0.19
198 0.19
199 0.19
200 0.18
201 0.14
202 0.12
203 0.1
204 0.09
205 0.1
206 0.12
207 0.12
208 0.15
209 0.14
210 0.12
211 0.13
212 0.13
213 0.12
214 0.1
215 0.12
216 0.11
217 0.2
218 0.21
219 0.2
220 0.22
221 0.23
222 0.25
223 0.23
224 0.23
225 0.17
226 0.18
227 0.21
228 0.18
229 0.18
230 0.16
231 0.16
232 0.18
233 0.17
234 0.19
235 0.15
236 0.15
237 0.14
238 0.14
239 0.14
240 0.12
241 0.12
242 0.08
243 0.09
244 0.09
245 0.1
246 0.11
247 0.15
248 0.16
249 0.17
250 0.17
251 0.17
252 0.17
253 0.16
254 0.17
255 0.19
256 0.17
257 0.17
258 0.18
259 0.18
260 0.18
261 0.19
262 0.17
263 0.12
264 0.18
265 0.19
266 0.21
267 0.25
268 0.3
269 0.33
270 0.34
271 0.35
272 0.35
273 0.41
274 0.4
275 0.35
276 0.3
277 0.26
278 0.26
279 0.24
280 0.18
281 0.11
282 0.08
283 0.08
284 0.09
285 0.09
286 0.08
287 0.11
288 0.13
289 0.16
290 0.24
291 0.32
292 0.4
293 0.47
294 0.54
295 0.57
296 0.57
297 0.58
298 0.57
299 0.56
300 0.51
301 0.44
302 0.36
303 0.3
304 0.27
305 0.25
306 0.18
307 0.12
308 0.13
309 0.19
310 0.25
311 0.28
312 0.33
313 0.41
314 0.47
315 0.55
316 0.62
317 0.66
318 0.66