Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4KET5

Protein Details
Accession A0A3N4KET5   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
342-372NEARREPKPMPMPMKKGRKVKKVQVESEEEVHydrophilic
NLS Segment(s)
PositionSequence
307-308RR
311-363EARRLDDERREAEWRKEEARREAERREEGRRNEARREPKPMPMPMKKGRKVKK
Subcellular Location(s) mito 9.5, cyto_mito 8.5, nucl 7, cyto 6.5, pero 2, cysk 2
Family & Domain DBs
Amino Acid Sequences MDPYMTMSLLRPTLWPDLIPHLRGKRLLILPGDCPAPAPTTPPAAATEEKQKRSQTSWTQYLTPKSTPTTPETTRVSVDASPARAHKLPPLPPPPAPPAAPMPPTPDTARTTAPEVFYTPETTRTAPELVPAPTSTNPRRTKAQPQQPPALAGAPPRGFRPLTRTESFLKPPEFGFDISLWCRFAPSYKPGRLMHVQFREITLQVVPSQPGGLDVGAFMNKAASAITNMVRRQGFLRMTSSFRELAVRPGALRMALEDWPSSEGGLGVGGETLRWVAEPVVLFCEVGDVEFVRDGGREDPRRAEEARRVEEARRLDDERREAEWRKEEARREAERREEGRRNEARREPKPMPMPMKKGRKVKKVQVESEEEVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.23
3 0.22
4 0.3
5 0.35
6 0.36
7 0.4
8 0.4
9 0.44
10 0.45
11 0.44
12 0.43
13 0.42
14 0.45
15 0.42
16 0.39
17 0.37
18 0.37
19 0.36
20 0.27
21 0.25
22 0.21
23 0.19
24 0.16
25 0.18
26 0.18
27 0.22
28 0.22
29 0.22
30 0.23
31 0.24
32 0.26
33 0.25
34 0.34
35 0.38
36 0.41
37 0.45
38 0.47
39 0.47
40 0.49
41 0.56
42 0.55
43 0.56
44 0.6
45 0.57
46 0.59
47 0.6
48 0.63
49 0.58
50 0.5
51 0.44
52 0.4
53 0.41
54 0.39
55 0.39
56 0.4
57 0.38
58 0.42
59 0.43
60 0.42
61 0.39
62 0.36
63 0.33
64 0.26
65 0.28
66 0.25
67 0.22
68 0.22
69 0.23
70 0.26
71 0.25
72 0.25
73 0.28
74 0.32
75 0.36
76 0.42
77 0.48
78 0.48
79 0.48
80 0.52
81 0.5
82 0.46
83 0.41
84 0.35
85 0.33
86 0.34
87 0.34
88 0.3
89 0.31
90 0.29
91 0.31
92 0.3
93 0.29
94 0.27
95 0.27
96 0.29
97 0.24
98 0.26
99 0.26
100 0.25
101 0.22
102 0.2
103 0.19
104 0.18
105 0.2
106 0.17
107 0.19
108 0.2
109 0.2
110 0.2
111 0.2
112 0.21
113 0.17
114 0.18
115 0.18
116 0.16
117 0.17
118 0.16
119 0.17
120 0.17
121 0.24
122 0.26
123 0.33
124 0.36
125 0.38
126 0.44
127 0.46
128 0.54
129 0.57
130 0.64
131 0.63
132 0.64
133 0.68
134 0.63
135 0.59
136 0.49
137 0.4
138 0.31
139 0.23
140 0.23
141 0.19
142 0.18
143 0.18
144 0.19
145 0.18
146 0.18
147 0.23
148 0.25
149 0.3
150 0.3
151 0.33
152 0.34
153 0.38
154 0.41
155 0.4
156 0.33
157 0.27
158 0.26
159 0.26
160 0.23
161 0.19
162 0.17
163 0.13
164 0.14
165 0.14
166 0.15
167 0.13
168 0.11
169 0.11
170 0.09
171 0.1
172 0.12
173 0.18
174 0.25
175 0.27
176 0.33
177 0.33
178 0.38
179 0.41
180 0.41
181 0.42
182 0.38
183 0.37
184 0.32
185 0.32
186 0.29
187 0.24
188 0.21
189 0.13
190 0.1
191 0.09
192 0.1
193 0.09
194 0.08
195 0.08
196 0.07
197 0.07
198 0.07
199 0.05
200 0.04
201 0.04
202 0.05
203 0.05
204 0.05
205 0.04
206 0.04
207 0.04
208 0.04
209 0.04
210 0.03
211 0.04
212 0.07
213 0.1
214 0.14
215 0.14
216 0.18
217 0.19
218 0.19
219 0.19
220 0.23
221 0.22
222 0.2
223 0.24
224 0.22
225 0.24
226 0.25
227 0.27
228 0.21
229 0.2
230 0.21
231 0.18
232 0.2
233 0.2
234 0.19
235 0.16
236 0.17
237 0.17
238 0.14
239 0.13
240 0.1
241 0.09
242 0.1
243 0.11
244 0.1
245 0.1
246 0.12
247 0.12
248 0.1
249 0.08
250 0.07
251 0.06
252 0.06
253 0.05
254 0.04
255 0.04
256 0.04
257 0.04
258 0.04
259 0.04
260 0.03
261 0.04
262 0.04
263 0.04
264 0.07
265 0.08
266 0.09
267 0.11
268 0.11
269 0.11
270 0.1
271 0.11
272 0.09
273 0.08
274 0.08
275 0.06
276 0.06
277 0.07
278 0.07
279 0.06
280 0.07
281 0.08
282 0.12
283 0.2
284 0.24
285 0.27
286 0.32
287 0.35
288 0.39
289 0.4
290 0.42
291 0.42
292 0.46
293 0.48
294 0.47
295 0.47
296 0.45
297 0.49
298 0.47
299 0.43
300 0.4
301 0.39
302 0.39
303 0.43
304 0.47
305 0.44
306 0.45
307 0.47
308 0.46
309 0.5
310 0.53
311 0.51
312 0.52
313 0.55
314 0.58
315 0.6
316 0.65
317 0.66
318 0.64
319 0.66
320 0.68
321 0.7
322 0.68
323 0.69
324 0.68
325 0.64
326 0.69
327 0.71
328 0.68
329 0.68
330 0.72
331 0.73
332 0.71
333 0.75
334 0.68
335 0.68
336 0.71
337 0.71
338 0.72
339 0.71
340 0.74
341 0.75
342 0.82
343 0.81
344 0.83
345 0.84
346 0.84
347 0.85
348 0.86
349 0.88
350 0.87
351 0.87
352 0.84
353 0.82