Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4KX53

Protein Details
Accession A0A3N4KX53   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
182-209DKSVTREVRRKARKAKEKAKERVKGLKGBasic
NLS Segment(s)
PositionSequence
189-214VRRKARKAKEKAKERVKGLKGRYRGK
Subcellular Location(s) cyto 14.5, cyto_nucl 10.5, mito 6, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029071  Ubiquitin-like_domsf  
Amino Acid Sequences MIVNLEIRHNTATAAITASPDDSSLVSTLIPLIQPTVPYPPTKWDLCFGSVCLLPTRTLLSYHIHDGANLWVRPRAHSLDTGVFPLTLRFKQAGGKHTVQLALTTEYTVDAVKRELRMVVGETRSTGFCLYRKRDEAKRGDVERGLEVGAEEEMRRGVEMEAGKTLGECGVEDGEVLVWGFDKSVTREVRRKARKAKEKAKERVKGLKGRYRGKNVGVKNTDGGVNDERVINTNTDGEGASQSARVVVQSMGEDEWDSEDEEGEEAGVNG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.12
4 0.13
5 0.13
6 0.11
7 0.1
8 0.1
9 0.09
10 0.1
11 0.09
12 0.09
13 0.08
14 0.08
15 0.08
16 0.09
17 0.09
18 0.07
19 0.09
20 0.09
21 0.1
22 0.12
23 0.18
24 0.19
25 0.21
26 0.22
27 0.26
28 0.3
29 0.32
30 0.32
31 0.31
32 0.32
33 0.33
34 0.32
35 0.27
36 0.25
37 0.24
38 0.24
39 0.21
40 0.19
41 0.16
42 0.16
43 0.18
44 0.15
45 0.15
46 0.16
47 0.18
48 0.19
49 0.22
50 0.24
51 0.22
52 0.21
53 0.2
54 0.23
55 0.26
56 0.24
57 0.22
58 0.22
59 0.22
60 0.24
61 0.28
62 0.26
63 0.22
64 0.23
65 0.26
66 0.27
67 0.27
68 0.26
69 0.22
70 0.18
71 0.17
72 0.17
73 0.17
74 0.13
75 0.14
76 0.13
77 0.14
78 0.19
79 0.24
80 0.27
81 0.3
82 0.32
83 0.31
84 0.32
85 0.32
86 0.26
87 0.23
88 0.19
89 0.14
90 0.12
91 0.11
92 0.09
93 0.08
94 0.09
95 0.08
96 0.07
97 0.05
98 0.07
99 0.09
100 0.09
101 0.1
102 0.1
103 0.1
104 0.1
105 0.12
106 0.14
107 0.13
108 0.13
109 0.13
110 0.14
111 0.13
112 0.13
113 0.12
114 0.09
115 0.11
116 0.18
117 0.22
118 0.26
119 0.3
120 0.34
121 0.4
122 0.46
123 0.49
124 0.49
125 0.52
126 0.49
127 0.47
128 0.43
129 0.38
130 0.31
131 0.26
132 0.18
133 0.11
134 0.09
135 0.07
136 0.06
137 0.05
138 0.04
139 0.04
140 0.04
141 0.04
142 0.04
143 0.05
144 0.05
145 0.08
146 0.09
147 0.1
148 0.1
149 0.11
150 0.1
151 0.09
152 0.1
153 0.06
154 0.05
155 0.05
156 0.05
157 0.05
158 0.05
159 0.05
160 0.05
161 0.04
162 0.05
163 0.04
164 0.03
165 0.03
166 0.03
167 0.04
168 0.04
169 0.06
170 0.08
171 0.15
172 0.19
173 0.24
174 0.31
175 0.38
176 0.48
177 0.56
178 0.63
179 0.67
180 0.73
181 0.79
182 0.83
183 0.87
184 0.86
185 0.88
186 0.89
187 0.89
188 0.85
189 0.81
190 0.8
191 0.77
192 0.75
193 0.73
194 0.71
195 0.69
196 0.71
197 0.73
198 0.71
199 0.69
200 0.68
201 0.68
202 0.65
203 0.66
204 0.6
205 0.54
206 0.47
207 0.43
208 0.38
209 0.3
210 0.3
211 0.22
212 0.21
213 0.2
214 0.19
215 0.18
216 0.19
217 0.2
218 0.16
219 0.15
220 0.15
221 0.14
222 0.14
223 0.14
224 0.12
225 0.11
226 0.11
227 0.1
228 0.1
229 0.09
230 0.1
231 0.09
232 0.08
233 0.09
234 0.08
235 0.09
236 0.1
237 0.12
238 0.11
239 0.11
240 0.12
241 0.1
242 0.13
243 0.12
244 0.12
245 0.11
246 0.11
247 0.11
248 0.11
249 0.1
250 0.08