Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4KWE2

Protein Details
Accession A0A3N4KWE2    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
214-243ATGGKRRTSFRRFVKKIRRSFSKVTERLRDHydrophilic
NLS Segment(s)
PositionSequence
107-116PGRKRERLPR
137-143RVKARKT
218-232KRRTSFRRFVKKIRR
Subcellular Location(s) nucl 12, mito 10, cyto_nucl 9, cyto 4
Family & Domain DBs
Amino Acid Sequences MSNQPPTRSYSTSSGITQASRPHQATPYAPPYQYQSRLPLPQAPTTPLPPPRTNTTTAIPYIRVNPPSLPVSRVLFPSQPRPLKWREHPGLSRIPRLVPTPETPTPPGRKRERLPREVSSAPGSLRDKDRGWSIDGRVKARKTVKRGLATPSAPEQGPEPSNDTTRTWPLMDMERLSLHEGLSLNPATREGGGDGDGGEEAEDESMTGVTQSLATGGKRRTSFRRFVKKIRRSFSKVTERLRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.33
3 0.32
4 0.3
5 0.31
6 0.31
7 0.35
8 0.35
9 0.35
10 0.37
11 0.39
12 0.4
13 0.41
14 0.43
15 0.41
16 0.4
17 0.37
18 0.4
19 0.44
20 0.45
21 0.4
22 0.39
23 0.41
24 0.45
25 0.46
26 0.47
27 0.43
28 0.44
29 0.42
30 0.41
31 0.38
32 0.36
33 0.4
34 0.41
35 0.44
36 0.42
37 0.44
38 0.47
39 0.48
40 0.49
41 0.46
42 0.43
43 0.4
44 0.39
45 0.36
46 0.3
47 0.27
48 0.28
49 0.29
50 0.27
51 0.25
52 0.23
53 0.25
54 0.27
55 0.27
56 0.23
57 0.21
58 0.22
59 0.22
60 0.24
61 0.23
62 0.23
63 0.24
64 0.3
65 0.36
66 0.38
67 0.38
68 0.41
69 0.44
70 0.48
71 0.53
72 0.56
73 0.52
74 0.55
75 0.56
76 0.55
77 0.6
78 0.54
79 0.51
80 0.42
81 0.38
82 0.32
83 0.32
84 0.3
85 0.23
86 0.23
87 0.26
88 0.27
89 0.29
90 0.3
91 0.34
92 0.38
93 0.41
94 0.46
95 0.46
96 0.52
97 0.54
98 0.63
99 0.66
100 0.66
101 0.66
102 0.61
103 0.61
104 0.54
105 0.5
106 0.42
107 0.34
108 0.26
109 0.25
110 0.22
111 0.18
112 0.2
113 0.21
114 0.19
115 0.2
116 0.23
117 0.19
118 0.21
119 0.22
120 0.22
121 0.24
122 0.26
123 0.28
124 0.3
125 0.29
126 0.33
127 0.39
128 0.42
129 0.44
130 0.49
131 0.53
132 0.53
133 0.54
134 0.53
135 0.51
136 0.46
137 0.42
138 0.36
139 0.31
140 0.26
141 0.24
142 0.2
143 0.17
144 0.17
145 0.16
146 0.17
147 0.17
148 0.19
149 0.21
150 0.21
151 0.21
152 0.23
153 0.24
154 0.2
155 0.19
156 0.2
157 0.22
158 0.23
159 0.2
160 0.19
161 0.18
162 0.19
163 0.2
164 0.18
165 0.13
166 0.14
167 0.13
168 0.12
169 0.15
170 0.15
171 0.13
172 0.12
173 0.13
174 0.11
175 0.11
176 0.11
177 0.09
178 0.09
179 0.09
180 0.09
181 0.09
182 0.08
183 0.08
184 0.07
185 0.06
186 0.05
187 0.04
188 0.04
189 0.04
190 0.04
191 0.04
192 0.04
193 0.04
194 0.04
195 0.04
196 0.04
197 0.05
198 0.05
199 0.06
200 0.08
201 0.09
202 0.16
203 0.19
204 0.25
205 0.28
206 0.34
207 0.42
208 0.48
209 0.57
210 0.62
211 0.7
212 0.71
213 0.79
214 0.85
215 0.85
216 0.87
217 0.87
218 0.86
219 0.83
220 0.84
221 0.83
222 0.83
223 0.82