Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4KKL5

Protein Details
Accession A0A3N4KKL5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
21-48NVPKTRKTYCKGKSCKKHTQHKVTQYKAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MSWERSSGHSKPAFATTGYVNVPKTRKTYCKGKSCKKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECTICKTKAQLALKRCKHFELGGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.29
3 0.21
4 0.22
5 0.23
6 0.23
7 0.2
8 0.24
9 0.26
10 0.28
11 0.31
12 0.33
13 0.39
14 0.42
15 0.52
16 0.55
17 0.63
18 0.7
19 0.76
20 0.8
21 0.82
22 0.87
23 0.86
24 0.88
25 0.87
26 0.88
27 0.86
28 0.86
29 0.87
30 0.79
31 0.79
32 0.72
33 0.66
34 0.58
35 0.51
36 0.4
37 0.32
38 0.3
39 0.3
40 0.29
41 0.26
42 0.31
43 0.35
44 0.38
45 0.43
46 0.47
47 0.43
48 0.5
49 0.57
50 0.54
51 0.56
52 0.55
53 0.55
54 0.54
55 0.57
56 0.48
57 0.44
58 0.41
59 0.34
60 0.37
61 0.39
62 0.38
63 0.33
64 0.4
65 0.44
66 0.52
67 0.61
68 0.64
69 0.63
70 0.67
71 0.74
72 0.74
73 0.73
74 0.7
75 0.65
76 0.62
77 0.6
78 0.55
79 0.5
80 0.47
81 0.41
82 0.35
83 0.33
84 0.32
85 0.36
86 0.42
87 0.44
88 0.47
89 0.57
90 0.64
91 0.69
92 0.66
93 0.61
94 0.56
95 0.51
96 0.5
97 0.5
98 0.51
99 0.52
100 0.55
101 0.52
102 0.5
103 0.49
104 0.42