Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4KSU2

Protein Details
Accession A0A3N4KSU2   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
25-44YGKLPSKKDILKNKLKERKYBasic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR006760  Endosulphine  
Pfam View protein in Pfam  
PF04667  Endosulfine  
Amino Acid Sequences MLPAQKNKVDISSLTEEEQRLFRLYGKLPSKKDILKNKLKERKYFDSGDYALSKAGKASDVGVTNIGSQHPLPENIPHHQITSPGTPTGSGSSSSPVKESSLLHAKSPMGSQQPIEGEELSSANSAEEEGKAAAEQTAPEGSSTETNAVPIPSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.3
3 0.28
4 0.27
5 0.28
6 0.23
7 0.2
8 0.19
9 0.2
10 0.22
11 0.25
12 0.32
13 0.39
14 0.45
15 0.46
16 0.49
17 0.52
18 0.53
19 0.59
20 0.6
21 0.61
22 0.64
23 0.7
24 0.77
25 0.8
26 0.79
27 0.78
28 0.76
29 0.75
30 0.7
31 0.64
32 0.55
33 0.51
34 0.47
35 0.42
36 0.35
37 0.27
38 0.22
39 0.19
40 0.17
41 0.11
42 0.11
43 0.08
44 0.07
45 0.08
46 0.1
47 0.11
48 0.11
49 0.11
50 0.11
51 0.11
52 0.11
53 0.1
54 0.08
55 0.07
56 0.08
57 0.08
58 0.09
59 0.09
60 0.13
61 0.16
62 0.17
63 0.21
64 0.19
65 0.19
66 0.18
67 0.19
68 0.17
69 0.17
70 0.17
71 0.13
72 0.13
73 0.12
74 0.12
75 0.13
76 0.11
77 0.09
78 0.08
79 0.11
80 0.13
81 0.13
82 0.13
83 0.12
84 0.12
85 0.13
86 0.14
87 0.17
88 0.24
89 0.24
90 0.24
91 0.26
92 0.26
93 0.25
94 0.25
95 0.23
96 0.18
97 0.18
98 0.18
99 0.19
100 0.2
101 0.2
102 0.2
103 0.17
104 0.13
105 0.13
106 0.13
107 0.1
108 0.09
109 0.08
110 0.07
111 0.06
112 0.07
113 0.07
114 0.07
115 0.08
116 0.07
117 0.08
118 0.08
119 0.08
120 0.08
121 0.08
122 0.08
123 0.08
124 0.1
125 0.1
126 0.1
127 0.11
128 0.12
129 0.13
130 0.14
131 0.15
132 0.13
133 0.14
134 0.15