Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4KQ50

Protein Details
Accession A0A3N4KQ50   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MGSEQSKPKAEPKPKRRTLRGFFHRGSHydrophilic
NLS Segment(s)
PositionSequence
7-26KPKAEPKPKRRTLRGFFHRG
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MGSEQSKPKAEPKPKRRTLRGFFHRGSKKTATDESIPAVVVEQVSASPADRTAPEPPTTSGVPESKLCRSTISINAEPHTTEITTPPNIPVHDKVVNSRSSGPAEPTPEAPALATAEYEARIPSSTQIPTDIPSTTTATTTVAPPIQSHDTQQETQSDQAEPYPQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.88
3 0.9
4 0.9
5 0.89
6 0.89
7 0.88
8 0.86
9 0.78
10 0.78
11 0.77
12 0.69
13 0.67
14 0.61
15 0.55
16 0.51
17 0.52
18 0.46
19 0.41
20 0.41
21 0.36
22 0.31
23 0.27
24 0.21
25 0.18
26 0.14
27 0.1
28 0.08
29 0.05
30 0.04
31 0.05
32 0.05
33 0.05
34 0.05
35 0.06
36 0.07
37 0.07
38 0.1
39 0.14
40 0.17
41 0.18
42 0.19
43 0.2
44 0.23
45 0.22
46 0.21
47 0.2
48 0.18
49 0.18
50 0.19
51 0.21
52 0.21
53 0.22
54 0.21
55 0.19
56 0.2
57 0.22
58 0.25
59 0.29
60 0.3
61 0.3
62 0.3
63 0.29
64 0.27
65 0.24
66 0.19
67 0.12
68 0.08
69 0.08
70 0.1
71 0.11
72 0.11
73 0.12
74 0.13
75 0.13
76 0.16
77 0.16
78 0.18
79 0.2
80 0.2
81 0.22
82 0.24
83 0.25
84 0.24
85 0.24
86 0.22
87 0.21
88 0.21
89 0.21
90 0.2
91 0.22
92 0.21
93 0.21
94 0.21
95 0.18
96 0.18
97 0.14
98 0.12
99 0.1
100 0.09
101 0.08
102 0.06
103 0.06
104 0.07
105 0.07
106 0.06
107 0.06
108 0.07
109 0.07
110 0.09
111 0.13
112 0.13
113 0.13
114 0.16
115 0.16
116 0.17
117 0.19
118 0.17
119 0.14
120 0.16
121 0.18
122 0.16
123 0.16
124 0.15
125 0.15
126 0.15
127 0.15
128 0.16
129 0.15
130 0.15
131 0.15
132 0.19
133 0.23
134 0.23
135 0.25
136 0.28
137 0.32
138 0.33
139 0.35
140 0.34
141 0.32
142 0.34
143 0.33
144 0.27
145 0.23
146 0.24