Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4KSQ6

Protein Details
Accession A0A3N4KSQ6   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
101-122ADAEKKHRDKVHRKKLRALGFEBasic
NLS Segment(s)
PositionSequence
105-116KKHRDKVHRKKL
Subcellular Location(s) cyto_nucl 13.333, cyto 12, nucl 10.5, mito_nucl 6.832, cyto_pero 6.832
Family & Domain DBs
InterPro View protein in InterPro  
IPR010920  LSM_dom_sf  
IPR044642  PTHR15588  
IPR001163  Sm_dom_euk/arc  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
Amino Acid Sequences MEGAEPPTLPPQMFTTSAQLLDLTDKKLLVALRDGRKLIGVLRSWDQRLYVNDSYCDIPRGVFIVRGENVLLLGEIDLDREDDIPFRQASVEEVFAGQRQADAEKKHRDKVHRKKLRALGFEDEGEVLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.25
4 0.25
5 0.24
6 0.2
7 0.17
8 0.19
9 0.2
10 0.17
11 0.16
12 0.15
13 0.15
14 0.18
15 0.18
16 0.14
17 0.19
18 0.25
19 0.29
20 0.33
21 0.33
22 0.31
23 0.3
24 0.29
25 0.25
26 0.22
27 0.18
28 0.18
29 0.21
30 0.24
31 0.25
32 0.24
33 0.23
34 0.21
35 0.22
36 0.27
37 0.26
38 0.24
39 0.24
40 0.25
41 0.25
42 0.22
43 0.21
44 0.13
45 0.1
46 0.09
47 0.1
48 0.09
49 0.1
50 0.09
51 0.11
52 0.11
53 0.12
54 0.12
55 0.1
56 0.1
57 0.07
58 0.07
59 0.04
60 0.03
61 0.03
62 0.03
63 0.03
64 0.04
65 0.04
66 0.04
67 0.05
68 0.05
69 0.06
70 0.07
71 0.09
72 0.09
73 0.09
74 0.09
75 0.09
76 0.11
77 0.12
78 0.12
79 0.1
80 0.11
81 0.11
82 0.11
83 0.12
84 0.09
85 0.07
86 0.07
87 0.1
88 0.14
89 0.19
90 0.27
91 0.37
92 0.42
93 0.5
94 0.55
95 0.63
96 0.69
97 0.76
98 0.79
99 0.79
100 0.8
101 0.82
102 0.85
103 0.84
104 0.79
105 0.73
106 0.68
107 0.61
108 0.56
109 0.47