Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4L6L5

Protein Details
Accession A0A3N4L6L5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
66-91PPPAANPTSKPKRRTRTSPSSSKPTTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
Amino Acid Sequences TPSPATAPPRRRTSKLSPTPVLAPAPADPDVSPLEHMRHLRAQFEALRPRSQSPSPSPSPTSTPTPPPAANPTSKPKRRTRTSPSSSKPTTTADLLAHYTFTLSHLPALTHHSRTATLTLTPTTPSSPGHLTLNLRPTTTLRGGSHTTYTIPPHGLPITVTTASPSPTSAPITAAYALAELPLKHLPALRYAKSFVSVVQRATVVGRVEVRERCGGGRVWTGRRWADGRFEAVRGGGGGGEGEEVVVRIEGVRGEKVGVWVGGRRVKDVGSVRWEKVVDRAQRMWSACWRVLEEEGGGGVGVLEEASTSAATATPPPPPVKARSQQPPAPPAAAAAHSKHIPFPIDASTTFVPTIGWCRRDAHTGWWSMLFVDGVRLEIDPVSGDAVWTDKLSGDGGGGGEGERRVLKGGMGMREVRERVGRFVERGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.78
3 0.78
4 0.72
5 0.69
6 0.68
7 0.63
8 0.55
9 0.44
10 0.35
11 0.27
12 0.27
13 0.24
14 0.22
15 0.17
16 0.19
17 0.2
18 0.19
19 0.19
20 0.18
21 0.2
22 0.24
23 0.26
24 0.28
25 0.33
26 0.34
27 0.34
28 0.33
29 0.35
30 0.36
31 0.42
32 0.47
33 0.43
34 0.46
35 0.47
36 0.5
37 0.5
38 0.48
39 0.48
40 0.46
41 0.51
42 0.51
43 0.54
44 0.54
45 0.51
46 0.53
47 0.49
48 0.48
49 0.44
50 0.46
51 0.44
52 0.46
53 0.44
54 0.42
55 0.45
56 0.43
57 0.44
58 0.43
59 0.49
60 0.55
61 0.61
62 0.66
63 0.69
64 0.74
65 0.78
66 0.82
67 0.82
68 0.82
69 0.84
70 0.86
71 0.83
72 0.83
73 0.76
74 0.69
75 0.62
76 0.54
77 0.48
78 0.39
79 0.35
80 0.26
81 0.25
82 0.25
83 0.22
84 0.18
85 0.15
86 0.13
87 0.11
88 0.12
89 0.12
90 0.1
91 0.11
92 0.11
93 0.12
94 0.13
95 0.2
96 0.22
97 0.22
98 0.23
99 0.22
100 0.23
101 0.24
102 0.25
103 0.19
104 0.17
105 0.16
106 0.16
107 0.16
108 0.16
109 0.15
110 0.15
111 0.14
112 0.13
113 0.15
114 0.16
115 0.17
116 0.18
117 0.2
118 0.22
119 0.25
120 0.32
121 0.3
122 0.28
123 0.27
124 0.26
125 0.28
126 0.28
127 0.28
128 0.21
129 0.24
130 0.27
131 0.27
132 0.27
133 0.23
134 0.22
135 0.19
136 0.2
137 0.18
138 0.17
139 0.15
140 0.16
141 0.16
142 0.14
143 0.12
144 0.13
145 0.14
146 0.13
147 0.13
148 0.12
149 0.12
150 0.13
151 0.13
152 0.11
153 0.09
154 0.1
155 0.12
156 0.12
157 0.12
158 0.11
159 0.13
160 0.12
161 0.11
162 0.09
163 0.08
164 0.07
165 0.06
166 0.07
167 0.05
168 0.07
169 0.08
170 0.08
171 0.08
172 0.11
173 0.11
174 0.18
175 0.23
176 0.23
177 0.24
178 0.25
179 0.25
180 0.24
181 0.24
182 0.18
183 0.2
184 0.2
185 0.19
186 0.18
187 0.18
188 0.16
189 0.17
190 0.17
191 0.1
192 0.09
193 0.1
194 0.1
195 0.14
196 0.14
197 0.16
198 0.15
199 0.15
200 0.14
201 0.15
202 0.15
203 0.14
204 0.18
205 0.19
206 0.22
207 0.23
208 0.26
209 0.25
210 0.26
211 0.26
212 0.22
213 0.24
214 0.22
215 0.23
216 0.21
217 0.21
218 0.19
219 0.17
220 0.16
221 0.11
222 0.09
223 0.05
224 0.04
225 0.03
226 0.03
227 0.03
228 0.03
229 0.03
230 0.02
231 0.03
232 0.03
233 0.03
234 0.03
235 0.03
236 0.03
237 0.04
238 0.06
239 0.06
240 0.06
241 0.07
242 0.08
243 0.08
244 0.09
245 0.08
246 0.08
247 0.09
248 0.13
249 0.16
250 0.16
251 0.16
252 0.17
253 0.16
254 0.22
255 0.23
256 0.23
257 0.27
258 0.31
259 0.3
260 0.33
261 0.33
262 0.28
263 0.31
264 0.35
265 0.32
266 0.33
267 0.36
268 0.35
269 0.39
270 0.4
271 0.37
272 0.35
273 0.35
274 0.32
275 0.31
276 0.29
277 0.26
278 0.26
279 0.24
280 0.18
281 0.12
282 0.1
283 0.09
284 0.07
285 0.05
286 0.04
287 0.03
288 0.02
289 0.02
290 0.02
291 0.02
292 0.02
293 0.03
294 0.03
295 0.03
296 0.03
297 0.04
298 0.05
299 0.08
300 0.09
301 0.12
302 0.16
303 0.17
304 0.2
305 0.23
306 0.28
307 0.34
308 0.4
309 0.45
310 0.51
311 0.58
312 0.6
313 0.63
314 0.63
315 0.57
316 0.51
317 0.43
318 0.35
319 0.29
320 0.26
321 0.23
322 0.2
323 0.21
324 0.21
325 0.22
326 0.22
327 0.22
328 0.21
329 0.19
330 0.19
331 0.19
332 0.2
333 0.2
334 0.23
335 0.22
336 0.21
337 0.21
338 0.18
339 0.15
340 0.13
341 0.21
342 0.22
343 0.23
344 0.24
345 0.27
346 0.3
347 0.35
348 0.36
349 0.36
350 0.36
351 0.37
352 0.37
353 0.35
354 0.33
355 0.27
356 0.26
357 0.18
358 0.11
359 0.12
360 0.1
361 0.1
362 0.1
363 0.1
364 0.1
365 0.1
366 0.1
367 0.08
368 0.08
369 0.09
370 0.08
371 0.08
372 0.07
373 0.09
374 0.1
375 0.09
376 0.09
377 0.08
378 0.09
379 0.1
380 0.1
381 0.08
382 0.08
383 0.08
384 0.08
385 0.08
386 0.07
387 0.09
388 0.09
389 0.1
390 0.1
391 0.11
392 0.13
393 0.13
394 0.13
395 0.17
396 0.22
397 0.25
398 0.28
399 0.3
400 0.31
401 0.38
402 0.38
403 0.36
404 0.38
405 0.35
406 0.36
407 0.42
408 0.43