Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4KKF9

Protein Details
Accession A0A3N4KKF9    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
2-21VDWYRYRKHILRPKLYPFYHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 11, mito 6, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
IPR038717  Tc1-like_DDE_dom  
Gene Ontology GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF13358  DDE_3  
Amino Acid Sequences GVDWYRYRKHILRPKLYPFYHKIRAQKGAAILMEDGAGPHSNHLLEEERLREGIVQKEGPSSSPDLNPIESIWNIMKDNLSARIPKVTKTKEIMSVLVEEWEVIPQEKIDSLIECMPKRVTACIKDKGGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.8
3 0.76
4 0.73
5 0.69
6 0.67
7 0.66
8 0.64
9 0.62
10 0.59
11 0.64
12 0.58
13 0.55
14 0.49
15 0.43
16 0.38
17 0.31
18 0.24
19 0.17
20 0.15
21 0.12
22 0.09
23 0.07
24 0.08
25 0.06
26 0.07
27 0.08
28 0.08
29 0.08
30 0.1
31 0.11
32 0.11
33 0.13
34 0.15
35 0.14
36 0.14
37 0.14
38 0.14
39 0.14
40 0.16
41 0.16
42 0.15
43 0.15
44 0.17
45 0.17
46 0.16
47 0.15
48 0.14
49 0.13
50 0.12
51 0.15
52 0.14
53 0.14
54 0.13
55 0.12
56 0.12
57 0.1
58 0.11
59 0.09
60 0.1
61 0.1
62 0.1
63 0.1
64 0.09
65 0.1
66 0.12
67 0.13
68 0.13
69 0.13
70 0.21
71 0.21
72 0.25
73 0.32
74 0.33
75 0.36
76 0.39
77 0.42
78 0.41
79 0.42
80 0.39
81 0.31
82 0.3
83 0.24
84 0.21
85 0.18
86 0.11
87 0.09
88 0.09
89 0.09
90 0.07
91 0.07
92 0.07
93 0.08
94 0.08
95 0.1
96 0.1
97 0.1
98 0.13
99 0.17
100 0.23
101 0.23
102 0.25
103 0.25
104 0.27
105 0.27
106 0.31
107 0.34
108 0.36
109 0.43
110 0.48