Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4KY85

Protein Details
Accession A0A3N4KY85    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
20-60VVKNTERKKDRNKMMQLHKKKSFRARVNDRRMRNRPRRGGGBasic
NLS Segment(s)
PositionSequence
26-61RKKDRNKMMQLHKKKSFRARVNDRRMRNRPRRGGGG
Subcellular Location(s) mito 11.5, mito_nucl 11.333, nucl 10, cyto_nucl 8.166, cyto 5
Family & Domain DBs
Amino Acid Sequences MKMYAPTVWGSSKYVWWRLVVKNTERKKDRNKMMQLHKKKSFRARVNDRRMRNRPRRGGGGGGGGGVVDLDLELGLGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.31
3 0.32
4 0.36
5 0.38
6 0.45
7 0.45
8 0.48
9 0.52
10 0.58
11 0.64
12 0.64
13 0.67
14 0.69
15 0.72
16 0.74
17 0.74
18 0.75
19 0.74
20 0.8
21 0.83
22 0.82
23 0.81
24 0.8
25 0.74
26 0.71
27 0.71
28 0.7
29 0.67
30 0.68
31 0.71
32 0.73
33 0.8
34 0.83
35 0.81
36 0.81
37 0.83
38 0.84
39 0.83
40 0.83
41 0.81
42 0.79
43 0.78
44 0.71
45 0.66
46 0.57
47 0.51
48 0.4
49 0.31
50 0.25
51 0.18
52 0.14
53 0.09
54 0.07
55 0.03
56 0.02
57 0.02
58 0.02