Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4KXZ1

Protein Details
Accession A0A3N4KXZ1    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
35-57RTPYTLPPTKKPKTKRTTSSTTTHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 13, cyto_nucl 11.666, cyto_mito 9.666, nucl 9, mito_nucl 7.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
IPR047154  UBL4A-like  
Gene Ontology GO:0005829  C:cytosol  
GO:0006620  P:post-translational protein targeting to endoplasmic reticulum membrane  
Pfam View protein in Pfam  
PF12754  Blt1  
PF17183  Blt1_C  
PROSITE View protein in PROSITE  
PS50053  UBIQUITIN_2  
Amino Acid Sequences MTELSFTKQFLATLATRNVHIPADFCEDPRKLPSRTPYTLPPTKKPKTKRTTSSTTTSIPSANISIKSLRGAQISHEIPSTPLSSTILTLKHNLSKATGLPIDKLKLLLKGKVLTDLKTLEELGIVDGVDVGFTVMVMGGASPAPSAPPEDKGLVDPGEDKGAVKKSALGEEKFWQDLGAFLKERLGSSEVLEEPEHVLETFRVAWGKRTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.26
3 0.26
4 0.27
5 0.28
6 0.24
7 0.23
8 0.18
9 0.17
10 0.24
11 0.24
12 0.24
13 0.29
14 0.28
15 0.3
16 0.36
17 0.37
18 0.31
19 0.37
20 0.45
21 0.47
22 0.5
23 0.52
24 0.53
25 0.56
26 0.63
27 0.62
28 0.61
29 0.63
30 0.67
31 0.72
32 0.73
33 0.75
34 0.77
35 0.81
36 0.81
37 0.8
38 0.8
39 0.76
40 0.73
41 0.66
42 0.59
43 0.51
44 0.43
45 0.35
46 0.26
47 0.22
48 0.18
49 0.16
50 0.15
51 0.15
52 0.14
53 0.14
54 0.15
55 0.16
56 0.16
57 0.15
58 0.14
59 0.14
60 0.21
61 0.21
62 0.2
63 0.19
64 0.17
65 0.16
66 0.18
67 0.17
68 0.1
69 0.09
70 0.1
71 0.1
72 0.1
73 0.12
74 0.12
75 0.12
76 0.14
77 0.15
78 0.17
79 0.18
80 0.18
81 0.16
82 0.16
83 0.15
84 0.16
85 0.17
86 0.14
87 0.14
88 0.15
89 0.15
90 0.14
91 0.15
92 0.12
93 0.16
94 0.17
95 0.17
96 0.18
97 0.19
98 0.19
99 0.25
100 0.25
101 0.2
102 0.21
103 0.2
104 0.18
105 0.17
106 0.17
107 0.1
108 0.09
109 0.08
110 0.06
111 0.06
112 0.05
113 0.04
114 0.04
115 0.04
116 0.03
117 0.03
118 0.03
119 0.02
120 0.02
121 0.02
122 0.02
123 0.02
124 0.02
125 0.02
126 0.03
127 0.03
128 0.03
129 0.03
130 0.03
131 0.03
132 0.04
133 0.07
134 0.08
135 0.11
136 0.13
137 0.14
138 0.15
139 0.16
140 0.18
141 0.16
142 0.15
143 0.14
144 0.13
145 0.13
146 0.13
147 0.12
148 0.14
149 0.17
150 0.17
151 0.16
152 0.19
153 0.19
154 0.27
155 0.32
156 0.29
157 0.29
158 0.33
159 0.36
160 0.33
161 0.31
162 0.23
163 0.18
164 0.19
165 0.2
166 0.2
167 0.18
168 0.17
169 0.21
170 0.21
171 0.22
172 0.22
173 0.2
174 0.16
175 0.17
176 0.22
177 0.19
178 0.21
179 0.21
180 0.18
181 0.18
182 0.18
183 0.17
184 0.12
185 0.13
186 0.1
187 0.13
188 0.13
189 0.13
190 0.16
191 0.16