Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4L4Y1

Protein Details
Accession A0A3N4L4Y1    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
74-95AAPPVSPKRGRKPKPKADGEDGBasic
98-119GGEPVKKRGRGRPKKVVAAQEEBasic
NLS Segment(s)
PositionSequence
79-112SPKRGRKPKPKADGEDGEDGGEPVKKRGRGRPKK
Subcellular Location(s) cyto_nucl 11.5, nucl 11, cyto 10, mito 6
Family & Domain DBs
Amino Acid Sequences MTDTEKPTAKNTKNEGQFWLAVFECCESPPKIDFDKLAEKCNYKNATTARVMFNGKRKALRDAELALNGGTGAAAPPVSPKRGRKPKPKADGEDGEDGGEPVKKRGRGRPKKVVAAQEEEEEQITTAEEDAST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.6
3 0.54
4 0.49
5 0.41
6 0.38
7 0.29
8 0.22
9 0.2
10 0.17
11 0.14
12 0.13
13 0.15
14 0.13
15 0.15
16 0.17
17 0.21
18 0.22
19 0.23
20 0.24
21 0.26
22 0.35
23 0.34
24 0.37
25 0.37
26 0.36
27 0.36
28 0.43
29 0.41
30 0.31
31 0.35
32 0.31
33 0.33
34 0.34
35 0.35
36 0.29
37 0.29
38 0.31
39 0.29
40 0.35
41 0.35
42 0.35
43 0.36
44 0.35
45 0.38
46 0.38
47 0.37
48 0.31
49 0.28
50 0.27
51 0.24
52 0.22
53 0.16
54 0.13
55 0.1
56 0.08
57 0.05
58 0.03
59 0.02
60 0.02
61 0.02
62 0.02
63 0.06
64 0.08
65 0.11
66 0.16
67 0.21
68 0.32
69 0.43
70 0.52
71 0.6
72 0.7
73 0.77
74 0.83
75 0.86
76 0.82
77 0.79
78 0.76
79 0.69
80 0.62
81 0.52
82 0.42
83 0.34
84 0.27
85 0.2
86 0.17
87 0.13
88 0.13
89 0.18
90 0.23
91 0.28
92 0.38
93 0.49
94 0.57
95 0.66
96 0.74
97 0.77
98 0.81
99 0.83
100 0.81
101 0.75
102 0.71
103 0.63
104 0.55
105 0.47
106 0.38
107 0.33
108 0.25
109 0.2
110 0.13
111 0.11
112 0.09
113 0.08